ESTScan Details for Unigene SGN-U345232

Score 
238
Direction 
Forward
Predicted Peptide Sequence 
RGFFPNAYWYWIGVSALIGFIIVFNIFYRLALVFLNPFGKPQGMISEDSDDAKTQTLRKKYPXSEGQNKKKGMVLQFEPHSITFNEVTYS
VDMPQEMKNQGATEDRLVLLNGVCGAFRPGVLTALMGVSGAGKTTLMDVLAGEKQEDILRGRSRSLAXPKKQETFARICGYCEQNDIHSP
YVTVYESFXILSLGGVTLLDVDEKPKKIFVDKIMGLGELTPLKAPLVGLAGINGLLTDHP
Predicted Coding Sequence 
CGAGGGTTTTTCCCAAATGCATACTGGTACTGGATAGGTGTCAGCGCACTTATTGGTTTCATAATCGTCTTTAACATCTTCTACAGACTT
GCACTCGTTTTTCTCAACCCATTTGGTAAGCCGCAAGGTATGATATCAGAAGACAGTGATGATGCCAAAACACAAACACTGAGAAAGAAG
TATCCAXCTAGTGAGGGCCAGAATAAGAAAAAGGGAATGGTTCTTCAATTTGAACCGCATTCCATCACCTTCAATGAAGTTACGTACTCT
GTTGACATGCCTCAGGAAATGAAAAATCAAGGTGCCACTGAAGATAGATTGGTACTTCTGAATGGTGTATGCGGAGCTTTCAGGCCCGGT
GTTTTGACAGCATTGATGGGAGTTAGTGGCGCTGGAAAAACAACGTTAATGGATGTATTAGCCGGAGAAAAACAGGAGGATATATTGAGG
GGTAGATCAAGATCTCTGGCTXATCCGAAGAAGCAAGAAACATTTGCACGTATATGCGGATACTGTGAACAGAATGATATTCATTCACCT
TATGTTACAGTTTATGAGTCATTTAGNATACTCAGCTTGGGTGGCGTTACCCTTTTGGACGTTGATGAAAAACCCAAAAAGATTTTTGTT
GATAAAATTATGGGACTTGGGGAGCTTACACCATTAAAGGCCCCCTTGGTTGGGCTTGCAGGAATTAACGGGCTTTTAACGGACCACCCC
TAA
Edits in Original Sequence 
TTGCAGTTGTAAGATCCCGAGGGTTTTTCCCAAATGCATACTGGTACTGGATAGGTGTCAGCGC(5')CGAGGGTTTTTCCCAAATGCAT
ACTGGTACTGGATAGGTGTCAGCGCACTTATTGGTTTCATAATCGTCTTTAACATCTTCTACAGACTTGCACTCGTTTTTCTCAACCCAT
TTGGTAAGCCGCAAGGTATGATATCAGAAGACAGTGATGATGCCAAAACACAAACACTGAGAAAGAAGTATCCAXCTAGTGAGGGCCAGA
ATAAGAAAAAGGGAATGGTTCTTCAATTTGAACCGCATTCCATCACCTTCAATGAAGTTACGTACTCTGTTGACATGCCTCAGGAAATGA
AAAATCAAGGTGCCACTGAAGATAGATTGGTACTTCTGAATGGTGTATGCGGAGCTTTCAGGCCCGGTGTTTTGACAGCATTGATGGGAG
TTAGTGGCGCTGGAAAAACAACGTTAATGGATGTATTAGCCGGAcGAAAAACAGGAGGATATATTGAGGGGTAGATCAAGATCTCTGGCT
XATCCGAAGAAGCAAGAAACATTTGCACGTATATGCGGATACTGTGAACAGAATGATATTCATTCACCTTATGTTACAGTTTATGAGTCA
TTTAGNATACTCAGCTTGGGTGGCGTTACCCTTTTGGACGTTGATGAAAAACCCAAAAAGATTTTTGTTGATAAAATTATGGGACTTGGG
GAGCTTACACCATTAAAGGCCCCCTTGGTTGGGCTTGCAGGAATTAACGGGCTTTTAACGGACCACCCCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan