ESTScan Details for Unigene SGN-U345240

Score 
75
Direction 
Forward
Predicted Peptide Sequence 
LAGAPRGGGRSTTSGSPGLQEFGTREKDKWAKHRKIINPAVPSREVKGLSFNFVIGQPETVMLNNSCPIDGKMSALASISFDLPYRNNLK
FNVXMTISSNIFYLIEVDEHSSGSIGTDIAXDHDTIVLPPIDNMLALAYLANVLVKDLFPL
Predicted Coding Sequence 
XXATTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTACAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGAGAAAGACAAA
TGGGCCAAACATAGAAAAATCATCAATCCTGCXGTTCCATCTAGAGAAGTTAAAGGTCTGTCATTCAACTTTGTGATTGGTCAACCAGAA
ACTGTAATGTTGAACAATTCTTGCCCTATCGATGGAAAAATGTCTGCTCTTGCTTCTATCTCCTTTGATTTACCTTATCGTAATAATCTA
AAATTTAATGTCATXATGACTATTTCGAGTAATATCTTCTACCTGATTGAAGTAGACGAGCATAGTAGTGGTTCTATAGGGACGGATATC
GCCXTGGATCATGATACAATTGTTCTTCCACCAATTGATAATATGCTCGCTCTTGCTTATCTGGCTAATGTTCTGGTTAAAGATCTCTTT
CCGCTTTGA
Edits in Original Sequence 
(5')XXATTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTACAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGAGAAAGA
CAAATGGGCCAAACATAGAAAAATCATCAATCCTGCXGTTCCATCTAGAGAAGTTAAAGGTCTGTCATTCAACTTTGTGATTGGTCAACC
AGAAACTGTAATGTTGAACAATTCTTGCCCTATCGATGGAtAAAATGTCTGCTCTTGCTTCTATCTCCTTTGATTTACCTTATCGTAATA
ATCTAAAATTTAATGTCATXATGACTATTTCGAGTAATATCTTCTACCTGAtTTGAAGTAGACGAGCATAGTAGTGGTTCTATAGGGACG
GATATCGCCXTGGATCATGATACAATTGTTCTTCCACCAATTGATAATATGCTCGCTCTTGCTTATCTGGCTAATGTTCTGGTTAAAGAT
CTCTTTCCGCTTTGA(3')AGCTTGAGTTAGACAACTGGAGAATCATTTTATGGTTCAAACAAGTCGAATCTTGTCTGGATCATTATTTG
TCAGGACTATATTTGCGTAAGTTCCTTGGCTTGTACAGGACATTTTAGTCATGTTGCACTTTATGCATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan