Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U345251

Score 
850
Direction 
Forward
Predicted Peptide Sequence 
MILVYEYMSNGPLRDHIYGSSLPTLTWKQRLEICIGAARGLHYLHTGSTQGIIHRDIKTTNILLDEDFVAKMADFGLSKTGPSLEQTHVS
TAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALDPALPREQVNLAEWAMQQHKKGSLEKIIDPHLAGTISPEALRKYVEA
AEKCLAEYGVDRPTMGDVLWNLEYALQLESATPSSVPVKNENENENSQPSSSKQPGTNSKGLKKPQLIDINDDSGVVVGSPMFLESFQGK
NN
Predicted Coding Sequence 
ATGATTCTAGTCTATGAGTACATGTCTAATGGTCCTTTGCGTGACCATATTTATGGTTCCAGTTTGCCAACTCTGACATGGAAACAAAGG
CTTGAAATCTGCATAGGAGCTGCTCGAGGACTGCACTACCTTCACACTGGTTCAACTCAGGGAATAATACATCGCGATATAAAAACTACA
AACATCCTCCTTGATGAGGACTTTGTGGCAAAGATGGCTGATTTTGGCTTGTCAAAAACCGGTCCTTCACTGGAGCAAACACATGTTAGC
ACAGCAGTGAAGGGTAGTTTTGGTTACCTTGATCCAGAGTACTTCAGAAGACAACAACTAACAGAAAAATCTGATGTGTACTCGTTTGGG
GTAGTCCTTTTTGAGGTACTATGTGCAAGGCCTGCACTTGATCCTGCGTTGCCAAGAGAACAAGTGAATTTAGCAGAATGGGCAATGCAG
CAACACAAAAAGGGCTCTCTGGAGAAGATCATAGACCCTCATCTTGCAGGAACCATCAGCCCTGAGGCGTTAAGGAAATACGTGGAAGCT
GCAGAGAAATGCTTGGCAGAATATGGGGTTGATAGGCCTACAATGGGAGATGTTTTGTGGAACTTAGAATATGCCTTGCAGCTTGAAAGT
GCAACACCGAGTAGTGTTCCAGTGAAGAATGAGAATGAGAATGAAAATTCCCAGCCAAGTTCTTCAAAACAGCCTGGAACGAATTCCAAA
GGCCTAAAAAAACCTCAGCTCATTGACATTAATGATGATTCTGGAGTGGTTGTTGGTTCTCCTATGTTCTTAGAAAGTTTTCAGGGAAAA
AATAACTGA
Edits in Original Sequence 
CGCTTCACAGGGCATCAACGAATTCCTGACAGAAATTGAGTTGCTATCCAAGCTTAGGCATCGACATCTTGTTTCACTCATTGGTTATTG
TGATGAACAATCAGAAATGATTCTAGTCTATGAGTACATGTCTAATGGTCCTTTGCGTGACCATATTTATGGTTCCAG
(5')ATGATTCT
AGTCTATGAGTACATGTCTAATGGTCCTTTGCGTGACCATATTTATGGTTCCAGTTTGCCAACTCTGACATGGAAACAAAGGCTTGAAAT
CTGCATAGGAGCTGCTCGAGGACTGCACTACCTTCACACTGGTTCAACTCAGGGAATAATACATCGCGATATAAAAACTACAAACATCCT
CCTTGATGAGGACTTTGTGGCAAAGATGGCTGATTTTGGCTTGTCAAAAACCGGTCCTTCACTGGAGCAAACACATGTTAGCACAGCAGT
GAAGGGTAGTTTTGGTTACCTTGATCCAGAGTACTTCAGAAGACAACAACTAACAGAAAAATCTGATGTGTACTCGTTTGGGGTAGTCCT
TTTTGAGGTACTATGTGCAAGGCCTGCACTTGATCCTGCGTTGCCAAGAGAACAAGTGAATTTAGCAGAATGGGCAATGCAGCAACACAA
AAAGGGCTCTCTGGAGAAGATCATAGACCCTCATCTTGCAGGAACCATCAGCCCTGAGGCGTTAAGGAAATACGTGGAAGCTGCAGAGAA
ATGCTTGGCAGAATATGGGGTTGATAGGCCTACAATGGGAGATGTTTTGTGGAACTTAGAATATGCCTTGCAGCTTGAAAGTGCAACACC
GAGTAGTGTTCCAGTGAAGAATGAGAATGAGAATGAAAATTCCCAGCCAAGTTCTTCAAAACAGCCTGGAACGAATTCCAAAGGCCaTAA
AAAAACCTCAGCTCATTGACATTAATGATGATTCTGGAGTGGTTGTTGGTTCTCCTATGTTCTTAGAAAGTTTTCAGGGAAAAAATAACT
GA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan