ESTScan Details for Unigene SGN-U345253

Score 
379
Direction 
Forward
Predicted Peptide Sequence 
HDXPLITHGITAXAVAXRTSGSPGLQEFGTRVFEIDGPNAEKAAMKAVDFDGVEFHGRVLTVKLDDGRRLKEKIEERNTWHEAKEGPGRD
FKKVLAIQPENWQAVVRAFXENQEGVMLTGXTEVICLQCCSPLKSIQERIWLNGELYARRGDMHRARETFEKMCARGIKPTFYVYTKTAE
RWFEEAKKTGLTFNAIXILGISSMLTAKHFIWIEPRKWAREMGEGGY
Predicted Coding Sequence 
NTGANNCATGATATNCCTTTGATTACTCATGGTATCACCGCGGNGGCGGTCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTC
GGCACGAGGGTTTTTGAAATTGATGGTCCAAATGCTGAGAAAGCAGCTATGAAGGCAGTGGATTTTGATGGTGTTGAATTTCATGGAAGG
GTGTTGACTGTGAAATTGGATGATGGGAGGAGATTGAAAGAGAAAATAGAGGAGAGGAACACGTGGCATGAGGCGAAGGAGGGGCCCGGG
AGAGATTTCAAGAAGGTTCTGGCAATACAGCCGGAGAATTGGCAGGCGGTTGTTCGGGCTTTTGAXGAGAATCAAGAAGGTGTTATGCTT
ACTGGAATXACTGAAGTAATCTGCTTGCAGTGCTGTAGTCCCTTAAAATCCATCCAGGAAAGAATTTGGCTTAATGGTGAACTCTATGCA
AGGAGGGGAGACATGCATCGTGCACGTGAAACCTTTGAGAAAATGTGTGCGCGAGGAATAAAACCAACCTTTTATGTATATACCAAAACT
GCTGAGCGATGGTTTGAGGAAGCCAAAAAAACGGGTCTGACATTTAATGCAATCATXATTTTGGGAATATCATCTATGCTAACTGCCAAA
CATTTCATATGGATTGAGCCGAGGAAATGGGCAAGGGAGATGGGAGAAGGAGGGTATTGA
Edits in Original Sequence 
TTTTTGAAATATGATGGTCCAAATGCTGAGAA(5')NTGANNCATGATATNCCTTTGATTACTCATGGTATCACCGCGGNGGCGGTCGCT
XCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGTTTTTGAAATaTGATGGTCCAAATGCTGAGAAAGCAGCTATGAA
GGCAGTGGATTTTGATGGTGTTGAATTTCATGGAAGGGTGTTGACTGTGAAATTGGATGATGGGAGGAGATTGAAAGAGAAAATAGAGGA
GAGGAACACGTGGCATGAGGCGAAGGAGGGGCCCGGGAGAGATTTCAAGAAGGTTCTGGCAATACAGCCGGAGAATTGGCAGGCGGTTGT
TCGGGCTTTTGAXGAGAATCAAGAAGGTGTTATGCTTACTGGAATXACTGAAGTAATCTGCTTGCAGTGCTGTAGTCCCTTAAAATCCAT
CCAGGAAAGAATTTGGCTTAATGGTGAACTaCTATGCAAGGAGGGGAGACATGCATCGTGCACGTGAAACCTTTGAGAAAATGTGTGCGC
GAGGAATAAAACCAACCTTTTATGTATATACCAAAACTGCTGAGCGATGGTTTGAGGAAGCCAAAAAAACGGGTCTGACATTTAATGCAA
TCATXATTTTGGGAATATCATCTATGCTAACTGCCAAACATTTCATATGGATTGAGCCGAGGAAATGGGCAAGGGAGATGGGAGAAGGAG
GGTATTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan