ESTScan Details for Unigene SGN-U345288

Score 
-200
Direction 
Forward
Predicted Peptide Sequence 
VAGAPRGGGRSTTSGSPGLQVFGAIISIISCAWGVTTLGGAKGVGESTTSAVVLSLVGIFVADFALSYCFFQGAGDSLKNCCDISYVIHF
LKFHKKKKKKLEGGPXYPIRPIVSRITIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILL
KFAVNFLKSAHFLTNRPEIGKIPYKSKEYTEIRLSVVPVWNKSPLFKNVGLQRPRGEKPAIGPKRPLLEPFPLINFFGVQGPKNPKLEP
Predicted Coding Sequence 
XXAGTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTACAACTAGTGGATCCCCCGGGCTGCAGGTTTTTGGTGCAATTATATCCATCATA
AGCTGTGCTTGGGGAGTCACCACACTGGGAGGTGCTAAAGGGGTTGGAGAGTCTACAACTTCAGCTGTAGTTTTATCTCTTGTTGGCATA
TTCGTAGCGGACTTTGCTCTCTCATATTGTTTCTTCCAGGGTGCTGGTGACTCCCTGAAGAACTGTTGTGACATTTCTTATGTAATCCAT
TTTTTAAAGTTCCACAAAAAAAAAAAAAAAAAACTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCAC
TGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGG
CGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTG
TTAAAATTCGCGGTAAATTTTTTGAAATCAGCTCATTTTTTAACCAATAGGCCXGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAC
ACCGAGATACGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTTAAAAACGTGGGACTCCAACGGCCAAGGGGGGAAAAACCG
GCTATAGGGCCGAAGCGCCCACTACTGGAACCATTCCCCCTAATCAATTTTTTTGGGGTCCAGGGGCCTAAAAACCCTAAACTGGAACCC
TAA
Edits in Original Sequence 
(5')XXAGTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTACAACTAGTGGATCCCCCGGGCTGCAGGTTTTTGGTGCAATTATATCCAT
CATAAGCTGTGCTTGGGGAGTCACCACACTGGGAGGTGCTAAAGGGGTTGGAGAGTCTACAACTTCAGCTGTAGTTTTATCTCTTGTTGG
CATATTCGTAGCGGACTTTGCTCTCTCATATTGTTTCTTCCAGGGTGCTGGTGACTCCCTGAAGAACTGTaTGTGACATTTCTTATGTAA
TCCATTTTTTAAAGTTCCACAAAAAAAAAAAAAAAAAACTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAA
TTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCA
GCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTTAATA
TTTTGTTAAAATTCGCGGTAAATTTTTTGtAAATCAGCTCATTTTTTAACCAATAGGCCXGAAATCGGCAAAATCCCTTATAAATCAAAA
GAATACACCGAGATACGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTTAAAAACGTGGGACTCCAACGGCCAAGGGGGGAA
AAACCGGCTATAGGGCCGAAGCGCCCACTACTGGAACCATTCCCCCTAATCAATTTTTTTGGGGTCCAGGGGCCTAAAAACCCTAAACTG
GAACCCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan