ESTScan Details for Unigene SGN-U345348

Score 
-293
Direction 
Reverse
Predicted Peptide Sequence 
NAYNLPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRANWVPGP
Predicted Coding Sequence 
AACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGC
GAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGT
AATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCC
Edits in Original Sequence 
G(5')AACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAG
CTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGA
ATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan