ESTScan Details for Unigene SGN-U345472

Score 
664
Direction 
Forward
Predicted Peptide Sequence 
LKPKLELHRGGGRSRTSGSPGLQEIAKPSEVEEIGSSPLMTMINEIEEQTFDSSESFSLEIKERNLKTKKAKGKDIHTHSQIFKYAYAQL
EREKAQQQQNNNLTFSGVISMATNTDYKKRPVIEIGFKDLTVTLKGKRKHLLRSVNGKIMPGRITSVMGPSGAGKTTLLSALAGKTVGCT
ISGSILINGKSEPIRSYRKIVGFVPQDDIVHGXLAVEENLWFXARCRLSANFAKAGQVSICERVMVFLGLQRVRVSWFGQ
Predicted Coding Sequence 
XXNTTGAAACCAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAAATCGCAAAGCCATCT
GAAGTAGAGGAAATAGGATCTAGTCCCCTGATGACGATGATTAATGAGATTGAAGAACAAACTTTTGATAGTTCGGAATCTTTCAGTTTG
GAGATCAAAGAAAGAAATTTGAAAACCAAAAAGGCCAAAGGGAAAGATATTCATACTCATAGCCAAATCTTTAAGTATGCATATGCACAA
CTTGAGAGAGAAAAAGCTCAGCAACAGCAGAATAACAACCTTACTTTCTCTGGTGTAATCTCAATGGCCACAAATACTGATTACAAGAAA
AGACCTGTAATTGAGATAGGTTTTAAAGACTTAACTGTTACTTTGAAAGGAAAAAGGAAGCATCTGTTACGATCTGTTAATGGAAAAATC
ATGCCTGGTCGTATTACTTCTGTCATGGGTCCATCAGGAGCAGGGAAAACTACTCTCCTTTCAGCTCTTGCAGGAAAAACTGTTGGATGT
ACAATTTCTGGTTCCATTCTTATAAATGGAAAATCAGAACCAATTCGTTCGTACAGAAAAATCGTCGGTTTTGTGCCACAGGATGATATT
GTGCATGGCAANCTTGCTGTTGAGGAGAATCTATGGTTCANTGCAAGGTGCAGGTTGTCAGCAAATTTTGCAAAAGCAGGACAAGTTTCT
ATTTGTGAGAGAGTCATGGTTTTCTTGGGTTTACAGAGGGTGCGGGTTTCTTGGTTTGGACAG
Edits in Original Sequence 
(5')XXNTTGAAACCAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAAATCGCAAAGCg
CATCTGAAGTAGAGGAAATAGGATCTAGTCCCCTGATGACGATGATTAATGAGATTGAAGAACAAACTTTTGATAGTTCGGAATCTTTCA
GTTTGGAGATCAAAGAAAGAAATTTGAAAACCAAAAAGGCCAAAGGGAAAGATATTCATACTCATAGCCAAATCTTTAAGTATGCATATG
CACAACTTGAGAGAGAAAAAGCTCAGCAACAGCAGAATAACAACCTTACTTTCTCTGGTGTAATCTCAATGGCCACAAATACTGATTACA
AGAAAAGACCTGTAATTGAGATAGGTTTTAAAGACTTAACTGTTACTTTGAAAGGAAAAAGGAAGCATCTGTTACGATCTGTTAATGGAA
AAATCATGCCTGGTCGTATTACTTCTGTCATGGGTCCATCAGGAGCAGGGAAAACTACTCTCCTTTCAGCTCTTGCAGGAAAAACTGTTG
GATGTACAATTTCTGGTTCCATTCTTATAAATGGAAAATCAGAACCAATTCGTTCGTACAGAAAAATCGTCGGTTTTGTGCCACAGGATG
ATATTGTGCATGGCAANCTTGaCTGTTGAGGAGAATCTATGGTTCANTGCAAGGTGCAGGTTGTCAGCAAATTTTGCAAAAGCAGGACAA
GTTTCTATTTGTGAGAGAGTCATGGTTTTCTTGGGTTTACAGAGGGTGCGGGTTTCTTGGTTTGGACAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan