ESTScan Details for Unigene SGN-U345509

Score 
-233
Direction 
Reverse
Predicted Peptide Sequence 
AIQGGQLLGRAIGAGLFAITPTGERGMCCKAIKLGNARVFPVPXFLKDGPGNLIRPPLRGEWGPGP
Predicted Coding Sequence 
GCCATTCAGGGTGGGCAACTTTTGGGAAGGGCGATCGGGGCGGGCCTTTTTGCTATTACCCCAACTGGCGAAAGGGGGATGTGCTGCAAG
GCGATTAAATTGGGTAACGCCAGGGTTTTCCCCGTCCCNNCTTTTTTAAAAGACGGCCCCGGAAATTTAATAAGACCXCCCCTTAGGGGG
GAATGGGGGCCGGGCCCC
Edits in Original Sequence 
CATTCCTCCAAACATAAAATCGAATTTTTGTCACATTTTATTAAAATCATAGATCAAAGTACAAAAAAACATTTTTTTTTTCATCTATCC
CTATTTCTAGTCATGTAAAATTTTTCTAGCATTGTTGATAGATTCTTGTTTTTCACATGTGCAATATCCACCCAAGCATATTCCGGTGCC
TCTCTGAATGGGGACACTGCAGTAAAGTACACAATCTTGATTAGTCTTACATGGTGGTCCAAAAGCATCAC
(5')GCCATTCAGGGTGGG
CAACTTTTGGGAAGGGCGATCGGGGCGGGCCTTTTTGCTATTACCCCAACTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAATTGGGT
AACGCCAGGGTTTTCCCCGTCCCNNCTTTTTTAAAAGACGGCCCCGGAAATTTAATAAGACCXCCCCTTAGGGGGGAATGGGGGCCGGGC
CCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan