ESTScan Details for Unigene SGN-U345622

Score 
296
Direction 
Reverse
Predicted Peptide Sequence 
VLINGEKKGPVRGFWGYQNYTAQQKFPPKQMLWAQKGPLPQNCPAKGSPQQERMGGKWGTLLEVARGNPPIVYEPGKGALVQADWGIECL
QLGKIFDPVDQRLNSGYVNKKVQMIFRLGLVCFPPRPKVRPTMRQVMKSPNGNESLPVFEQQLSCIGFKRVNEIPAKFLEGFFTKTIKKS
XSFAIRGTKII
Predicted Coding Sequence 
GTCCTTATTAATGGGGAAAAGAAAGGCCCGGTTAGGGGATTTTGGGGTTACCAAAATTATACGGCCCAGCAAAAATTTCCCCCCAAACAA
ATGTTGTGGGCCCAAAAGGGTCCATTGCCCCAAAATTGCCCGGCCAAGGGAAGCCCTCAACAAGAACGAATGGGAGGCAAATGGGGTACT
CTTCTTGAAGTAGCTAGGGGAAACCCTCCTATTGTTTATGAACCAGGGAAAGGAGCTTTAGTACAAGCTGATTGGGGGATTGAATGTTTA
CAACTAGGTAAAATTTTTGATCCAGTTGATCAAAGGTTGAATTCAGGGTATGTAAATAAAAAGGTTCAAATGATTTTCAGACTTGGGCTT
GTTTGTTTTCCCCCAAGGCCAAAAGTTAGGCCAACAATGAGACAAGTAATGAAGTCCCCCAATGGAAATGAATCCCTTCCAGTTTTTGAG
CAACAGTTGAGTTGTATTGGATTTAAAAGGGTTAATGAAATCCCAGCCAAGTTTTTGGAAGGGTTTTTTACTAAAACAATCAAAAAATCA
XCGTCGTTCGCTATCCGTGGGACAAAAATCATTTAG
Edits in Original Sequence 
(5')GTCCTTATTAATGGGGAAAAGAAAGGCCCGGTTAGGGGATTTTGGGGTTACCAAAATTATACGGCCCAGCAAAAATTTCCCCCCAA
ACAAATGTTGTGGGCCCAAAAGGGTCCATTGCCCCAAAATTGCCCGGCCAAGGGAAGCCCTCAACAAGAACGAATGGGtAGGCAAATGGG
GTACTaCTTCTTGAAGTAGCTAGGGGAAACCCTCCTATTGTTTATGAACCAGGGAAAGGAGCTTTAGTACAAGCTGATTGGGGGATTGAA
TGTTTACAACTAGGTAAAATTTTTGATCCAGTTGATCAAAGGTTGAATTCAGGGTATGTAAATAAAAAGGTTCAAATGATTTTCAGACTT
GGGCTTGTTTGTTTTCCCCCAAGGCCAAAAGTTAGGCCAACAATGAGACAAGTAATGAAGTCCCCCAATGGAAATGAATCCCTTCCAGTT
TTTGAGCAACAGTTGAGTTGTATTGGATTTAAAAGGGTTAATGAAATCCCAGCCAAGTTTTTGGAAGGGTTTTTTACTAAAACAATCAAA
AAATCAXCGTCGTTCGCTATCCGTGGGACAAAAATCATTTAG(3')CCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan