ESTScan Details for Unigene SGN-U345682

Score 
501
Direction 
Forward
Predicted Peptide Sequence 
MGPSGSGKTTLLNVLAGQTKASPKLNLSGLLDINGVPFSNKIYKFAYVRQEDLFFSQLTVRETLSLAAELQLQDVSSIEERDEYVNNLLF
KTGLLADSQIGDAKVRGISGGEKKRLSLACELIASPSVVFADEPTTGSDATVFASPVFAGVMLWS
Predicted Coding Sequence 
ATGGGTCCATCAGGATCAGGAAAGACTACTCTTCTCAATGTTCTGGCGGGTCAAACAAAAGCATCACCTAAGTTGAATTTGTCTGGTCTT
TTGGACATCAACGGGGTGCCATTTTCAAACAAAATATACAAGTTTGCCTATGTTAGACAAGAAGATCTTTTCTTTTCCCAGTTGACTGTT
CGAGAAACTCTCTCTCTTGCAGCTGAACTGCAGCTACAGGACGTATCTTCAATAGAAGAGAGAGATGAATATGTGAACAATCTATTGTTT
AAAACAGGTTTGTTGGCTGATTCACAAATTGGTGATGCAAAAGTTCGTGGAATTAGTGGAGGTGAAAAGAAGCGCCTGTCGCTTGCATGT
GAGCTTATTGCCAGTCCATCTGTAGTTTTTGCTGATGAACCTACCACTGGAAGTGATGCTACTGTTTTTGCTAGTCCXGTGTTTGCTGGC
GTTATGCTTTGGTCATAA
Edits in Original Sequence 
GGTCGATTGCTAGCAATAATGGGTCCATCAGGATCAGGAAAGACTACTCTTCTCAATGTTCTGGCGGGTCAAACAAAAGCATCACCTAAG
TTGA
(5')ATGGGTCCATCAGGATCAGGAAAGACTACTCTTCTCAATGTTCTGGCGGGTCAAACAAAAGCATCACCTAAGTTGAATTTGT
CTGGTCTTTTGGACATCAACGGGGTGCCATTTTCAAACAAAATATACAAGTTTGCCTATGTTAGACAAGAAGATCTTTTCTTTTCCCAGT
TGACTGTTCGAGAAACTCTCTCTCTTGCAGCTGAACTGCAGCTACAGGACGTATCTTCAATAGAAGAGAGAGATGAATATGTGAACAATC
TATTGTTTAAAACAGGTTTGTTGtGCTGATTCACAAATTGGTGATGCAAAAGTTCGTGGAATTAGTGGAGGTGAAAAGAAGCGCCTGTCG
CTTGCATGTGAGCTTATTGCCAGTCCATCTGTAGTTTTTGCTGATGAACCTACCACTGGtAAGTGATGCTACTGTTTTTGCTAGTCCXGT
GTTTGCTGGCGTTATGCTTTGGTCATAA(3')TTTTTAGAAGCACGTATAGACCAAGGAGTGTCTTTATAAAATCAGAGGTTTTGAAGTA
GGATAACTATATATTTATGGCCACTATGCTTCCCTGTAGAGTGTAGTCTTCTCTAGAAGGGACTCCCAATTTTCACTTTTATCTCATCTA
TCTTTCACTTGTAATGGTGCTGACGTCCTGGCCACAACCATTATCCAGTTGTGCTGACTCCTTATTTACATGCTGTGTCAAACTTTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan