ESTScan Details for Unigene SGN-U345892

Score 
231
Direction 
Forward
Predicted Peptide Sequence 
IARNTLTKGNKAGAHRGGGRSRTSGSPGLQEFGTRVDYLLDEPVITATDNLQFSDGAFLEASDLSRPIEVDTSGFDMLEDYLAFFDADDN
FQSMGFNPPMMTGDDDHVSDLPSVEEKNIAEVNDQPNAPSEELVFFFNNDXSSGXGGGEKILNGQYYSLLNMKTDGEQRNCDSAGGATKV
QKKQKPTNNRKNQKTNAKQTRPTKRLLKNTETILRDPSTNKAYSNTMRSTNGTKPENAKGKNQKGSKEEGQYQLPDLRIKHTIAQIVRAN
XAIYTKKYRSRIALKPRP
Predicted Coding Sequence 
ATAGCTCGNAATACCCTCACTAAAGGGAACAAAGCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAG
GAATTCGGCACGAGGGTCGATTACTTGCTTGATGAACCAGTTATAACTGCAACTGATAACCTTCAATTCAGTGATGGAGCATTCCTTGAA
GCTAGTGATCTTTCAAGACCCATTGAGGTTGATACGTCAGGTTTTGACATGCTTGAGGATTACCTTGCATTCTTTGATGCAGACGATAAC
TTCCAAAGTATGGGTTTCAATCCACCAATGATGACCGGAGATGATGATCATGTGTCTGACTTACCATCTGTGGAGGAGAAGAATATTGCC
GAGGTGAATGACCAACCTAATGCACCAAGTGAAGAGCTTGTTTTTTTTTTTAATAATGATGNATCTTCGGGGXGGGGGGGGGGGGAAAAA
ATTTTAAATGGACAATACTACTCTTTATTGAATATGAAAACAGATGGTGAACAGAGGAACTGTGACAGCGCAGGGGGGGCTACAAAAGTA
CAAAAAAAGCAAAAACCAACAAACAACAGAAAAAACCAGAAAACAAACGCAAAACAAACCAGACCCACAAAACGCCTATTAAAAAACACA
GAAACAATACTAAGAGACCCATCGACAAACAAAGCATACAGTAACACCATGAGGTCAACAAACGGCACTAAACCGGAAAATGCTAAAGGA
AAAAACCAAAAGGGTAGCAAAGAAGAAGGCCAATATCAGCTACCTGATCTCCGTATTAAGCACACAATAGCACAGATAGTCCGAGCCAAC
XATGCAATCTACACCAAAAAGTACAGATCAAGAATTGCTCTAAAACCTCGGCCX
Edits in Original Sequence 
(5')ATAGCTCGNAATACCCTCACTAAAGGGAACAAAGCTGGAGCTcCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGC
TGCAGGAATTCGGCACGAGGGTCGATTACTTGCTTGATGAACCAGTTATAACTGCAACTGATAACCTTCAATTCAGTGATGGAGCATTCC
TTGAAGCTAGTGATCTTTCAAGACCCATTGAGGTTGATACGTCAGGTTTTGACATGCTTGAGGATTACCTTGCATTCTTTGATGCAGACG
ATAACTTCCAAAGTATGGGTTTCAATCCACCAATGATGACCGGAGATGATGATCATGTGTCTGACTTACCATCTGTGGAGGAGAAGAATA
TTGCCGAGGTGAATGACCAACCTAAtTGCACCAAGTGAAGAGCTTGtTTTTTTTTTTTAATAATGATGNATCTTCGGGGXGGGGGGGGGG
GGAAAAAATTTTAAATGGACAATACTACTCTTTATTGAATATGAAAACAGATGGTGAACAcGAGGAACTGTGACAGCGCAGGGGGGGCTA
CAAAAGTACAAAAAAAGCAAAAACCAACAAACAACAGAAAAAACCAGAAAACAAACGCAAAACAAACCAGACCCACAAAACGCCTATTAA
AAAACACAGAAACAATACTAAGAGACCCATCGACAAACAAAGCATACAcGTAACACCATGAGGTCAACAAACGGCACTAAACCGGAAAAT
GCTAAAGGAAAAAACCAAAAGGGTAGCAAtAGAAGAAGGCCAATATCAGCTACCTGATCTCCGTATTAAGCACACAATAGCACAGATAGT
CCGAGCCAACXATGCAATCTACACCAAAAAGTACAGATCAAGAATTGCTCTAAAACCTCGGCCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan