ESTScan Details for Unigene SGN-U345902

Score 
422
Direction 
Reverse
Predicted Peptide Sequence 
MSSQVTENQRENAEIFTGPTICKQKSQQLLEQINMPKGLLPLDDLIEIGHNKQTGFVWLKQKKAKENRFKKIGKLVWYDTEVTGFLEDRR
MKKLTGVKSKELLIWVTISDISIQVSDLEKITFATPSGISKAFPVSAFEE
Predicted Coding Sequence 
ATGTCATCTCAAGTAACAGAAAATCAACGTGAAAATGCAGAGATTTTCACTGGCCCAACGATCTGCAAGCAGAAATCTCAACAACTTTTG
GAGCAAATCAATATGCCAAAAGGGCTTCTTCCATTGGATGATCTAATAGAAATAGGACACAATAAGCAAACCGGATTTGTATGGCTGAAA
CAGAAGAAGGCAAAAGAAAATCGGTTTAAGAAAATCGGAAAACTTGTCTGGTATGACACCGAGGTCACCGGATTCCTTGAAGATCGCCGG
ATGAAGAAACTCACCGGCGTTAAAAGTAAGGAACTGTTGATCTGGGTAACAATTTCTGATATTTCTATTCAGGTCTCTGATTTAGAGAAA
ATTACATTTGCTACCCCTTCTGGAATTTCTAAAGCTTTTCCGGTGTCTGCGTTCGAGGAGTGA
Edits in Original Sequence 
GAAAATATTAAAATAATATTCTCTTTTGTACGAAAAGTGAAATGTAAAGTAAAAGTAAATTTTTAGTACAATAAATAAATAAAAGTACAC
AGAAAGGAAATTTCTTTTTTTTAGGAAAATAAGTTTCCTAATAGTTAATATTCGGTTAGTCCCTATAAAAGTGCATCAATTCTTATGCTC
CTCTTCACAAAAACAAAAATACCTTTGTCATACTCATTTCTACTTTGACAGATTGAAAAGGAATCCAATTACTTTAGGAAAATGTCATCT
CAAGTAACAGAAAATCAACGTGAAAATGCAGAGATTTT
(5')ATGTCATCTCAAGTAACAGAAAATCAACGTGAAAATGCAGAGATTTTC
ACTGGCCCAACGATCTGCAAGCAGAAATCTCAACAACTTTTGGAGCAAATCAATATGCCAAAAGGGCTTCTTCCATTGGATGATCTAATA
GAAATAGGACACAATAAGCAAACCGGATTTGTATGGCTGAAACAGAAGAAGGCAAAAGAAAATCGGTTTAAGAAAATCGGAAAACTTGTC
TGGTATGACACCGAGGTCACCGGATTCCTTGAAGATCGCCGGATGAAGAAACTCACCGGCGTTAAAAGTAAGGAACTGTTGATCTGGGTA
ACAATTTCTGATATTTCTATTCAGGTCTCTGATTTAGAGAAAATTACATTTGCTACCCCTTCTGGAATTTCTAAAGCTTTTCCGGTGTCT
GCGTTCGAGGAGTGA(3')TGTTCTATTTTTAAAGTTGTGAAATAATAATAGAAAAGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan