ESTScan Details for Unigene SGN-U345918

Score 
42
Direction 
Forward
Predicted Peptide Sequence 
GESYGHPKXXXXIEPVDPPGLQEFGTRSWAFLFYIDVSENMFTGSIPPALAQEREYADLLLLQNNFTGGIPSNYANCLSLQRLRVSNNSL
SGVVPSGIWSLPDLEIIDLTLNLFEGPVTSNIGEAKSLAQLILAYNQFNGLFPTDNITMFVHYRPINSEPRNSLFMGDIFPPSLLGGXPL
RKPLSNFLPFLKKSLESLVLSLVKSLLSPYTSKLQSNTMAEPSISIXGKNHDHSAFGRRXNLSCGVGKSSPENRXTLATFCPTCLGDLIS
HSTSGLPKPSSSSTTVIDILAPRFYKIKGPRCNMYELNSLKCFSTSPEFILLLFTLSAQVTALL
Predicted Coding Sequence 
XTAGGAGAATCGTACGGCCATCCCAAGGNGCNTTNCGNTATAGAACCCGTGGATCCCCCXGGGCTGCAGGAATTCGGCACGAGATCATGG
GCTTTTCTTTTTTACATTGATGTTTCTGAGAATATGTTTACTGGTTCGATACCGCCTGCCCTCGCCCAAGAAAGGGAGTATGCTGATCTT
TTGCTTCTCCAGAACAACTTCACTGGTGGGATACCTTCCAACTATGCTAATTGTTTGTCGTTGCAGCGTTTAAGGGTTAGCAACAATTCA
CTTTCAGGAGTAGTCCCTAGTGGAATTTGGAGTTTGCCAGATTTGGAAATCATTGATCTCACATTGAATCTATTTGAAGGCCCAGTGACA
TCAAATATCGGTGAGGCAAAGTCTTTAGCACAGTTGATTCTAGCCTACAACCAGTTCAATGGTCTATTTCCCACAGACAATATCACAATG
TTTGTTCATTATAGGCCAATTAATTCTGAGCCGCGAAATAGTCTCTTTATGGGTGATATTTTCCCACCAAGCCTATTAGGTGGAXATCCT
TTAAGGAAGCCTCTAAGTAACTTCCTCCCATTTTTGAAAAAGTCACTAGAGTCCTTGGTTCTCTCACTCGTGAAAAGCCTCCTATCCCCA
TACACTTCCAAACTTCAGTCAAATACAATGGCTGAGCCATCAATCTCCATTGXTGGGAAAAATCATGATCATTCCGCATTTGGTCGAAGA
TTNAACCTTTCTTGTGGAGTCGGCAAATCATCCCCTGAAAACCGTXCTACTTTGGCTACTTTCTGCCCGACATGTCTCGGAGACCTTATC
TCCCACTCTACTTCCGGATTACCAAAGCCTTCTTCATCTTCCACAACTGTCATCGATATACTCGCTCCTAGGTTTTACAAGATTAAAGGC
CCTCGTTGCAATATGTACGAACTTAACTCGCTAAAATGTTTCTCTACCTCACCCGAATTTATTCTGCTCCTCTTTACACTCTCTGCACAA
GTAACGGCGCTTCTCTAG
Edits in Original Sequence 
(5')XTAGGAGAATCGTACGGCCATCCCAAGGNGCNTTNCGNTATAGAACCCGTGGATCCCCCXGGGCTGCAGGAATTCGGCACGAGATC
ATGGGCTTTTCTTTTTTACATTGATGTTTCTGAGAATATGTTTACTGGTTCGATACCGCCTGCCCTCGCCCAAGAAAGGGAGTATGaCTG
ATCTTTTGCTTCTCCAGAACAACTTCACTGGTGGGATACCTTCCAACTATGCTAATTGTTTGTCGTTGCAGCGTTTAAGGGTTAGCAACA
ATTCACTTTCAGGAGTAGTCCCTAGTGGAATTTGGAGTTTGCCAGATTTGGAAATCATTGATCTCACATTGAATCTATTTGAAGGCCCAG
TGACATCAAATATCGGTGAGGCAAAGTCTTTAGCACAGTTGATTCTAGCCTACAACCAGTTCAATGGTCTATTTCCCACAGACAATATCA
CAATGTTTGTTCATTAgTAGGCCAATTAATTCTGAGCCGCGAAATAGTCTCTTTATGGGTGATATTTTCCCACCAAGCCTATTAGGTGGA
XATCCTTTAAGGAgAGCCTCTAAGTAACTTCCTCCCATTTTTGAAAAAGTCACTAGAGTCCTTGGTTCTCTCACTCGTGAAAAGCCTCCT
ATCCCCATACACTTCCAAACTTCAGTCAAATACAATGGCTGAGCCATCAATCTCCATTGXTGGGAAAAATCATGATCATTCCGCATTTGG
TCGAAGATTNAACCTTTCTTGTGGAGTCGGCAAATCATCCCCTGAAAACCGTXCTACTTTGGCTACTTTCTGCCCGACATGTCTCGGAGA
CCTTATCTCCCACTCTACTTCCGGATTACCAAAGCCTTCTTCATCTTCCACAACTGTCATCGATATACTCGCTCCTAGGTTTTACAAGAT
TAAAGGCCtCTCGTTGCAATATGTACGAACTTAACTCGCTAAAATGTTTCTCTACCTCACCCGtAATTTATTCTGCTCCTCTTTACACTC
TCTGCACAAGTAACGGCGCTTCTCTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan