ESTScan Details for Unigene SGN-U345984

Score 
539
Direction 
Forward
Predicted Peptide Sequence 
MGHTKAVRDIWFSNDGTKFLTAGYDKYIKYWDTETGQVIQTFTTGKIPYVVRLNPDEDKQNVLLAGMSDKKIVQWDINSGQITQEYDQHL
GAVNTITFVDNNRRFVTSSDDKSLRVWEYGIPVVIKYISEPHMHSMPSISPHPNGNWIAAQSLDNQILIYSTRERFQLNKKKRFAGHIVA
GYALPGXISHLMDGLSSQEMVKADAGFGIGNRVKVFKTLKCHDGVCIGAKWHPLEQSKVATCGWDGXDPILGLIFEHAIFVSIYFEEKLV
QPGGGLKEIKTPYMPGGGPTPFGTPWPGKNPPL
Predicted Coding Sequence 
ATGGGGCATACAAAGGCAGTGAGGGATATTTGGTTTAGCAATGACGGGACGAAGTTTTTGACAGCTGGATATGATAAGTACATTAAGTAT
TGGGATACAGAAACAGGACAAGTAATTCAAACGTTCACGACGGGTAAGATACCCTATGTGGTGAGGCTTAATCCTGATGAAGATAAGCAG
AATGTACTTTTGGCTGGTATGAGTGATAAGAAGATTGTGCAGTGGGATATAAACAGTGGACAGATTACACAAGAGTACGATCAACATCTG
GGGGCAGTTAATACAATTACCTTTGTGGATAATAACAGAAGGTTTGTGACCTCTAGTGATGATAAATCACTACGTGTTTGGGAATATGGT
ATTCCGGTTGTTATCAAGTATATAAGTGAACCCCATATGCATTCCATGCCATCTATTTCGCCCCATCCAAATGGGAATTGGATTGCAGCA
CAAAGTTTGGATAACCAGATTCTTATTTACAGTACGCGAGAGAGATTTCAGCTGAATAAAAAGAAAAGATTTGCTGGACACATTGTCGCT
GGTTATGCCCTGCCAGGTXCAATTTCTCACCTGATGGACGGTTTGTCTTCTCAAGAGATGGTGAAGGCAGATGCTGGTTTTGGGATTGGA
AATCGTGTXAAGGTCTTCAAAACTCTCAAGTGTCATGATGGGGTCTGTATTGGTGCAAAGTGGCATCCTCTGGAACAAAGTAAAGTTGCT
ACTTGTGGCTGGGATGGTXTTGATCCAATACTGGGACTAATTTTTGAACACGCCATTTTTGTCTCCATTTACTTTGAGGAAAAACTTGTT
CAACCTGGXGGTGGGCTTAAAGAAATCAAAACTCCTTATATGCCGGGGGGGGGTCCAACTCCTTTTGGAACCCCTTGGCCTGGGAAAAAC
CCACCCCTTTAA
Edits in Original Sequence 
GGTTTTTCCCTAAGCATGGTCATTTGATTTTGTCAGCTGGGATGGATACAAAGGTGAAAATTTGGGATGTTTACAATTCCGGTAAATGTA
TGAGGACTTACATGGGGCATACAAAGGCAGTGAGGGATATTTGGTTTAGCAATGACGGGACGAAGTTTTTGAC
(5')ATGGGGCATACAA
AGGCAGTGAGGGATATTTGGTTTAGCAATGACGGGACGAAGTTTTTGACAGCTGGATATGATAAGTACATTAAGTATTGGGATACAGAAA
CAGGACAAGTAATTCAAACGTTCACGACGGGTAAGATACCCTATGTGGTGAGGCTTAATCCTGATGAAGATAAGCAGAATGTACTTTTGG
CTGGTATGAGTGATAAGAAGATTGTGCAGTGGGATATAAACAGTGGACAGATTACACAAGAGTACGATCAACATCTGGGGGCAGTTAATA
CAATTACCTTTGTGGATAATAACAGAAGGTTTGTGACCTCTAGTGATGATAAATCACTACGTGTTTGGGAATATGGTATTCCGGTTGTTA
TCAAGTATATAAGTGAACCCCATATGCATTCCATGCCATCTATTTCGCCCCATCCAAATGGGAATTGGATTGCAGCACAAAGTTTGGATA
ACCAGATTCTTATTTACAGTACGCGAGAGAGATTTCAGCTGAATAAAAAGAAAAGATTTGCTGGACACATTGTCGCTGGTTATGCCCTGC
CAGGTXCAATTTCTCACCTGATGGACGGTTTGTCTTCTCAAGAGATGGTGAAGGCAGATGCTGGTTTTGGGATTGGAAATCGTGTXAAGG
TCTTCAAAACTCTCAAGTGTCATGATGGGGTCTGTATTGGTGCAAAGTGGCATCCTCTGGAACAAAGTAAAGTTGCTACTTGTGGCTGGG
ATGGTXTTGATCCAATACTGGGACTAATTTTTGAACACGCCATTTTTGTCTCCATTTACTTTGAGGAAAAACTTGTTCAACCTGGXGGTG
GGCTTAAAGAAATCAAAACTCCTTATATGCCGGGGGGGGGTCCAACTCCTTTTGGAAcCCCCTTGGCCTGGGAAAAACCCACCCCTTTAA
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan