ESTScan Details for Unigene SGN-U346093

Score 
422
Direction 
Reverse
Predicted Peptide Sequence 
MAEQDAAESRSAISFCKKRATSISTSFVPQPSVSAALFMGSQQSQGRPSGSTQGSQWSSAPSYMAGQGGQHQNQGQPSGFTQTPYKASPY
SMDGQRTHSMQGLTSGPVHNPLNETSHTSESVRDPASTFAQVPGQYEGIKQQKRPHPKGTILSNTNTPKWHAKGECKLGSIVSXEAAAFD
TVA
Predicted Coding Sequence 
ATGGCTGAACAAGATGCAGCAGAATCCAGGTCAGCCATCAGCTTTTGCAAGAAACGTGCAACAAGCATCTCCACCTCTTTCGTGCCCCAA
CCAAGTGTTTCAGCXGCACTCTTCATGGGATCACAGCAAAGCCAAGGTCGCCCATCAGGTTCAACGCAGGGTTCACAATGGTCATCTGCA
CCCTCTTATATGGCAGGACAAGGAGGACAGCATCAAAATCAAGGTCAGCCATCAGGTTTCACACAAACTCCTTATAAGGCATCACCTTAT
TCCATGGATGGACAAAGAACCCATTCAATGCAAGGTCTGACATCAGGACCTGTTCATAATCCACTAAATGAAACCTCACACACATCCGAA
TCAGTTAGAGATCCAGCATCAACTTTTGCACAAGTACCTGGGCAATATGAAGGCATCAAGCAACAGAAGAGGCCTCATCCCAAGGGGACA
ATATTGAGCAATACCAATACCCCCAAGTGGCACGCCAAGGGAGAATGTAAATTGGGAAGCATAGTTTCTXCTGAGGCAGCTGCTTTTGAT
ACAGTTGCCTAA
Edits in Original Sequence 
CCACCTCTTTCGTGCCCCAACCAAGTGTTTCAGCGCACTCTTCATGGGATCACAGCAAAGCCAAGGTCGCCCATCAGGTTCAAC(5')AT
GGCTGAACAAGATcGCAGCAGAATCCAGGTCAGCCATCAGCTTTTGCAAGAAACGTGCAACAAGCATCTCCACCTCTTTCGTGCCCCAAC
CAAGTGTTTCAGCXGCACTCTTCATGGGATCACAGCAAAGCCAAGGTCGCCCATCAGGTTCAACGCAGGGTTCACAATGGTCATCTGCAC
CCTCTTATATGGCAGGACAAGGAGGACAGCATCAAAATCAAGGTCAGCCATCAGGTTTCACACAAACTCCTTATAAGGCATCACCTTATT
CCATGGATGGACAAAGAACCCATTCAATGCAAGGTCTGACATCAGGACCTGTTCATAATCCACTAAATGAAACCTCACACACATCCGAAT
CAGTTAGAGATCCAGCATCAACTTTTGCACAAGTACCTGGGCAATATGtAAGGCATCAAGCAACAGAAGAGGCCTCATCCCAAGGGGACA
ATATTGAGCAATACCAATACCCCCAAGTGGCACGCCAAGGGAGAATGTAAATTGGGAAGCATAGTTTCTXCTGAGGCAGCTGCTTTTGAT
ACAGTTGCCTAA(3')TTGTACTATTGGTGAGAAGATATATTTATTTACTCTACATCTTGTACACTTAAGTTTTTCCCTTCATATTAATA
AAATGTATTTGCCTCGTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan