ESTScan Details for Unigene SGN-U346115

Score 
181
Direction 
Forward
Predicted Peptide Sequence 
AAXRTSGSPGLQEFGTSDDPAAVANCKHEYHSQCIVEWSQTNKECPIXWRVFALKDSASQELLSAMDIERNMRSMINVRHTNQNVETNHD
ATQQNDSDFEERIMDILAAATSIVRLVNRKRRQASSRIGPTQDVPSGPVGVSSNHTQNNESTVQIQRFGYFGDGSAASATSSSIRPGSSS
DTAHASDPTSLANHQLMVPHGQTHPEFLAICESIKAKRTSASAMYKDSISKSTPWFQGKIIRPAPPLVNDLARKNHRENNAGIAAVQELI
EXNELTLKRTGTAXTNCMWQGSLTFFRLREEVSPEFDFSAALX
Predicted Coding Sequence 
XCTGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACTAGCGATGATCCTGCTGCTGTAGCAAATTGTAAGCATGAA
TATCATTCGCAGTGTATTGTTGAATGGTCTCAAACAAACAAGGAGTGCCCAATTTGATGGAGGGTTTTTGCATTGAAAGACTCTGCAAGC
CAAGAGCTACTATCTGCGATGGATATTGAAAGGAACATGAGGTCAATGATTAATGTGCGTCATACTAACCAAAATGTAGAAACCAATCAT
GATGCCACACAGCAGAATGATTCAGATTTTGAGGAGCGAATTATGGACATTTTAGCTGCTGCGACCAGTATAGTGCGGCTTGTCAACAGA
AAGAGAAGACAGGCGTCTTCAAGAATCGGTCCTACACAGGATGTACCTTCAGGGCCGGTAGGAGTTAGCTCAAACCATACACAGAATAAT
GAATCCACAGTACAGATTCAACGCTTTGGATATTTTGGGGATGGGTCTGCTGCTTCTGCCACTTCATCTAGTATTAGACCTGGATCATCA
TCAGATACTGCCCATGCAAGTGATCCTACTAGCTTAGCCAACCACCAACTTATGGTCCCGCACGGTCAAACTCATCCXGAGTTTCTTGCA
ATTTGTGAATCTATAAAAGCCAAAAGGACTTCTGCTTCTGCGATGTATAAGGACTCAATCTCAAAAAGTACTCCGTGGTTTCAAGGAAAA
ATTATTAGGCCTGCCCCCCCACTGGTCAATGATTTGGCCAGAAAAAATCATCGTGAGAATAATGCTGGAATAGCTGCGGTTCAAGAATTG
ATTGAAXCAAATGAACTTACTTTAAAACGTACTGGAACTGCTXTGACCAACTGCATGTGGCAAGGGTCCCTTACATTTTTCCGGTTGAGG
GAGGAAGTATCCCCGGAATTTGACTTTTCAGCXGCCCTTAXX
Edits in Original Sequence 
(5')XCTGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACTAGCGATGATCCTGCTGCTGTAGCAAATTGTAAGCA
TGAATATCATTCGCAGTGTATTGTTGAATGGTCTCAAACAAACAAGGAGTGCCCAATTTGATGGAGGGTTTTTGCATTGAAAGACTCTGC
AAGCCAAGAGCTACTATCTGCGATGGATATTGAAAGGAACATGAGGTCAATGATTAATGTGCGTCATACTAACCAAAATGTAGAAACCAA
TCATGATGCCACACAGCAGAATGATTCAGATTTTGAGGAGCGAATTATGcGACATTTTAGCTGCTGCGACCAGTATAGTGCGGCTTGTCA
ACAGAAAGAGAAGACAGGCGTCTTCAAGAATCGGTCCTACACAGGATGTACCTTCAGGGCCGGTAGGAGTTAGCTCAAACCATACACAGA
ATAATGAATCCACAGTACAGATTCAACGCTTTGGATATTTTGGGGATGGGTCTGCTGCTTCTGCCACTTCATCTAGTATTAGACCTGGAT
CATCATCAGATACTGCCCATGCAAGTGATCCTAtCTAGCTTAGCCAACCACCAACTTATGGTCCCGCACGGTCAAACTCATCCXGAGTTT
CTTGCAATTTGTGAATCTATAAAAGCCAAAAGGACTTCTGCTTCTGCGATGTATAAGGACTCAATCTCAAAAAGTACTCCGTGGTTTCAA
GGAAAAATTATTAGGCCTGCCCCCCCACTGGTCAATGATTTGGCCAGAAAAAATCATCGTGAGAATAATGCTGGAATAGcCTGCGGTTCA
AGAATTGATTGAAXCAAATGAACTTACTTTAAAACGTACTGGAACTGCTXTGACCAACTGCATGTGGCAAGGGTCCCTTACaATTTTTCC
GGTTGAGGGAGGAAGTATCCCCGGAATTTGACTTTTCAGCXGCCCTTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan