ESTScan Details for Unigene SGN-U346130

Score 
341
Direction 
Forward
Predicted Peptide Sequence 
LELARLQVDTSGSKEFGXELFRTWKTRLHAEYLRYNTDEERLSHPPKDVVPEDWEFLIQYFGSQSFKAKSERNKINRKKQTTKHLCGSKS
FAEVEESLRDPLTGEKAPPDRVWELQHTRKNDKGELLWSDQQSQQIHGQIQELVVQQQYEQNMNPMTGDEILATVLGERTCYVRGKGYGK
TPLKKSRMRHGYLGSSLFSAIEGVRQEMQADMDRKLQEEREQMRAEMEKMFQAQMEEERKQMRLEIDKRIPDQMV
Predicted Coding Sequence 
CTGGAGCTCGCGCGCCTGCAGGTCGACACTAGTGGATCCAAAGAATTCGGCXACGAGCTTTTTAGAACGTGGAAGACTCGGTTGCATGCT
GAATACTTGCGTTATAATACTGATGAGGAGAGACTGTCCCATCCGCCAAAAGATGTTGTGCCTGAGGATTGGGAATTTCTTATACAATAT
TTTGGAAGCCAGTCATTCAAGGCTAAAAGCGAGAGAAATAAAATAAACAGGAAAAAGCAAACAACAAAGCATTTATGTGGTTCAAAGTCT
TTTGCAGAAGTAGAGGAATCACTGAGAGATCCTCTTACCGGAGAAAAGGCACCACCAGATCGTGTCTGGGAGCTCCAACATACGCGTAAG
AATGATAAAGGAGAACTGTTGTGGTCAGATCAACAATCACAACAAATTCACGGCCAGATCCAGGAACTTGTGGTTCAACAGCAATATGAA
CAAAACATGAATCCAATGACTGGAGATGAGATTTTAGCTACTGTACTTGGCGAGAGAACATGCTATGTCCGTGGAAAAGGTTATGGAAAG
ACGCCTCTAAAAAAGAGCCGCATGCGACATGGGTACTTGGGATCTAGCCTGTTTTCTGCAATAGAAGGTGTGCGCCAAGAGATGCAAGCT
GACATGGATCGTAAGTTGCAAGAGGAACGTGAACAAATGCGAGCTGAAATGGAGAAAATGTTTCAAGCACAGATGGAAGAGGAGCGCAAA
CAAATGCGACTAGAAATAGACAAAAGGATCCCAGATCAGATGGTG
Edits in Original Sequence 
CTTTTTAGAACGTGGA(5')CTGGAGCTCGCGCGCCTGCAGGTCGACACTAGTGGATCCAAAGAATTCGGCXACGAGCTTTTTAGAACGT
GGAAGACTCGGTTGCATGCTGAATACTTGCGTTATAATACTGATGAGGAGAGACTGTCCCATCCGCCAAAAGATGTTGTGCCTGAGGATT
GGGAATTTCTTATACAATATTTTGGAAGCCAGTCATTCAAGGCTAAAAGCGAGAGAAATAAAATAAACAGGAAAAAGCAAACAACAAAGC
ATTTATGTGGTTCAAAGTCTTTTGCAGAAGTAGAGGAATCACTGAGAGATCCTCTTACCGGAGAAAAGGCACCACCAGATCGTGTCTGGG
AGCTCCAACATACGCGTAAGAATGATAAAGGAGAACTGTTGTGGTCAGATCAACAATCACAACAAATTCACGGCCAGATCCAGGAACTTG
TGGTTCAACAGCAATATGAACAAAACATGAATCCAATGACTGGAGATGAGATTTTAGCTACTGTACTTGGCGAGAGAACATGCTATGTCC
GTGGAAAAGGTTATGGAAAGACGCCTCTAAAAAAGAGCCGCATGCGACATGGGTACTTGGGATCTAGCCTGTTTTCTGCAATAGAAGGTG
TGCGCCAAGAGATGCAAGCTGACATGGATCGTAAGTTGCAAGAGGAACGTGAACAAATGCGAGCTGAAATGGAGAAAATGTTTCAAGCAC
AGATGGAAGAGGAGCGCAAACAAATGCGACTAGAAATAGACAAAAGGATCCCAGATCAGATGGTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan