ESTScan Details for Unigene SGN-U346157

Score 
176
Direction 
Forward
Predicted Peptide Sequence 
NEXPIGXXTXDTALYRRAPPGGGRSRTSGSPGLQEFGRGIHQAVQTETRALSRNNNIHGIQSQMSSRSSTLTKLKFLCSFGGRIMPRPSD
GKLRYIGGDTAPRPFKKDVSWEEFWQKMLTLFNNCHTIKYQLPGEDLDALVSVSCDEDLQNMIEEFNVLEGDGSQKLRTFLFSYSDLDDS
LAGLENIDEXPEMQYVIAVNNMDFGLRGNSTALAALEKKTLDEFLNATIAGEDGQVARHVAGGCTSDPTFGMPLQGNLLMKGYHIYHLNP
WANLGMTPITRNLGQMTYGGLNGTLTFSIRGKFQA
Predicted Coding Sequence 
XXAAATGAANNNCCCATTGGANNCNCNACTGNTGACACAGCATTATACCGTAGAGCTCCACCAGGTGGCGGACGTTCCAGAACTAGTGGA
TCCCCCGGGCTGCAGGAATTCGGCAGAGGCATCCATCAAGCTGTGCAAACTGAAACTAGAGCCTTATCAAGAAATAACAACATTCATGGA
ATTCAAAGTCAAATGTCTTCTAGATCTAGTACATTAACAAAGTTGAAGTTCCTCTGCAGTTTTGGTGGTAGAATTATGCCTCGTCCAAGT
GATGGGAAACTTAGATATATTGGAGGTGATACXGCACCTCGTCCGTTTAAGAAAGATGTTTCTTGGGAGGAATTCTGGCAAAAGATGTTA
ACTTTATTTAACAATTGTCACACAATAAAATATCAGCTTCCTGGTGAGGATCTTGATGCATTAGTGTCAGTTTCTTGTGATGAAGACTTG
CAGAATATGATAGAGGAATTTAATGTATTAGAAGGTGATGGATCACAAAAATTGCGTACATTTCTCTTTTCTTACAGTGACTTGGATGAT
TCTCTGGCTGGTTTGGAGAATATTGATGAGATXCCAGAAATGCAGTATGTTATTGCTGTAAATAACATGGACTTTGGTTTAAGAGGAAAC
TCCACTGCTCTGGCAGCACTTGAGAAAAAAACXCTGGATGAGTTTCTGAATGCAACAATTGCTGGGGAGGATGGTCAAGTTGCTAGGCAT
GTGGCAGGGGGCTGTACTTCTGATCCAACATTTGGCATGCCTCTACAAGGTAATCTGCTCATGAAGGGGTATCATATTTATCACTTAAAT
CCTTGGGCAAACTTGGGCATGACTCCAATCACTAGAAACTTGGGCCAAATGACTTATGGGGGCCTTAATGGAACCTTAACCTTTTCTATA
CGGGGGAAATTTCAGGCX
Edits in Original Sequence 
(5')XXAAATGAANNNCCCATTGGANNCNCNACTGNTGACACAcGCATTATACCGTAGAGCTCCACCgAGGTGGCGGACGTTCCAGAACT
AGTGGATCCCCCGGGCTGCAGGAATTCGGCAcGAGGCATCCATCAAGCTGTGCAAACTGAAACTAGAGCCTTATCAAGAAATAACAACAT
TCATGGAATTCAAAGTCAAATGTCTTCTAGATCTAGTACATTAACAAAGTTGAAGTTCCTCTGCAGTTTTGGTGGTAGAATTATGCCTCG
TCCAAGTGATGGGAAACTTAGATATATTGGAGGTGATACXGCACCTCGTCCGTTTAAGAAAtGATGTTTCTTGGGAGGAATTCTGGCAAA
AGATGTTAACTTTATTTAACAATTGTCACACAATAAAATATCAGCTTCCTGGTGAGGATCTTGATGCATTAGTGTCAGTTTCTTGTGATG
AAGACTTGCAGAATATGATAGAGGAATTTAATGTATTAGAAGGTGATGGATCACAAAAATTGCGTACATTTCTCTTTTCTTACAGTGACT
TGGATGATTCTCTGGCTGGTTTGGAGAATATTGaATGAGATXCCAGAAATGCAGTATGTTATTGCTGTAAATAACATGGACTTTGGTTTA
AGAGGAAACTCCACTGCTCTGGCaAGCACTTGAGAAAAAAACXCTGGATGAGTTTCTGAATGCAACAATTGCTGGGGAGGATGGTCAAGT
TGCTAGGCATGTGGCAGGGGGCTGTACTTCTGATCCAACATTTGGCATGCCTCTaACAAGGTAATCTGCTCATGAAGGGGTATCATATTT
ATCACTTAAATCCTTGGGCAAACTTGGGCATGACTCCAATCACTAGAAACTTGGGCCAAATGtACTTATGGGGGCCTTAATGGAACCTTA
ACCTTTTCTATACGGGGGAAATTTCAGGCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan