ESTScan Details for Unigene SGN-U346185

Score 
254
Direction 
Forward
Predicted Peptide Sequence 
AKGXPGXRAXNXPNXHRKPPEVADVLELAGFHGLHEFGTRLLAKLSVLYKQRDLHFYPCWIYTLPSWLLSIPTSLLESIIWVAATYYVVG
FDPXNNQELPSVSVVLLIASEVKGLFRVMASLGRNMIVANTFGSFAMLVVMALGGFVISRDSIPSWWIWGYWFCPLMYAQNSASVNEFRG
HSWDKRFRDNISLGXDVIEGFVADFQRTNGIGXGVDALKGILNGQRPLTKILATSTHRDPQAFVQEKPPNKAKDLGGKKHGSLGEFGHCT
DPWRKTKPKGWFSSTLFWFKXKNLGGALGLTQGCGKKGSNRAGLYRGYGNGKG
Predicted Coding Sequence 
XXTGCNAAGGGNNGGCCCGGGCNTCGCGCCXCTAATGNTCCTAATANTCATAGGAAGCCTCCCGAGGTTGCGGACGTTCTAGAACTAGCX
GGATTCCACGGGCTGCATGAATTCGGTACGAGGCTGTTAGCCAAACTTTCCGTTCTGTACAAGCAGAGAGATTTACATTTCTACCCATGT
TGGATATATACTCTTCCGTCTTGGCTTTTGAGTATACCCACCTCACTTTTAGAGTCCATTATTTGGGTTGCAGCTACATACTATGTGGTT
GGCTTTGATCCTXCAAATAACCAGGAGCTTCCGTCAGTTTCTGTTGTACTTCTCATTGCATCAGAAGTCAAAGGACTTTTCCGTGTGATG
GCATCACTAGGCAGAAATATGATAGTTGCTAATACCTTTGGATCTTTTGCAATGTTGGTTGTCATGGCTCTCGGAGGATTTGTTATCTCA
AGAGATAGCATCCCAAGTTGGTGGATTTGGGGTTACTGGTTTTGCCCTTTGATGTATGCCCAGAATTCAGCTTCAGTGAATGAGTTCCGT
GGCCATTCTTGGGATAAGAGATTTAGGGACAACATATCTTTGGGTCXAGATGTTATTGAAGGGTTCGTAGCTGATTTCCAGAGAACTAAT
GGGATTGGAXTCGGGGTTGATGCATTGAAGGGGATATTAAATGGTCAAAGACCTTTGACGAAAATTTTGGCTACCTCAACCCATAGGGAC
CCACAAGCATTTGTTCAAGAAAAACCCCCAAACAAGGCCAAGGACTTGGGAGGGAAGAAACATGGTTCCTTGGGAGAGTTTGGACATTGC
ACTGATCCGTGGAGAAAAACAAAACCCAAGGGCTGGTTTTCGTCTACCCTTTTTTGGTTTAAGGXGAAAAATCTAGGGGGGGCCCTTGGG
TTAACTCAGGGTTGTGGGAAAAAGGGTTCTAACAGGGCTGGCCTTTACCGCGGTTACGGAAATGGGAAGGGG
Edits in Original Sequence 
(5')XXTGCNAAGGGNNGGCCCGGGCNTCGCGCCXCTAATGNTCCTAATANTCATAGGAAGCCTCCCGAGGTTGCGGACGTTCTAGAACT
AGCXGGATTCCACGGGCTGCATGAATTCGGTACGAGGCTGTTAGCCAAACTTTCCGTTCTGTACAAGCAGAGAGATTTACATTTCTACCC
ATGTTGGATATATACTCTTCCGTCTTGGCTTTTGAGTATACCCACCTCACTTTTAGAGTCCATTATTTGGGTTGCAGCTACATACTATGT
GGTTGGCTTTGATCCTXCAAATAACCAGGAGCTTCCGTCAGTTTCTGTTGTACTTCTCATTGCATCAGAAGTCAAtAGGACTTTTCCGTG
TGATGGCATCACTAGGCAGAAATATGATAGTTGCTAATACCTTTGGATCTTTTGCAATGTTGGTTGTCATGGCTCTCGGAGGATTTGTTA
TCTCAAGAGATAGCATCCCAAGTTGGTGGATTTGGGGTTACTGGTTTTGCCCTTTGATGTATGCCCAGAATTCAGCTTCAGTGAATGAGT
TCCGTGGCCATTCTTGGGATAAGAGATTTAGGGACAACATATCTTTGGGTCXAGATGTTATTGAAGGGTTCGTAGCTGATTTCCAGAGAA
CTAATGGGATTGGAXTCGGGGTTGATGCATTGAAGGGGATATTAAtATGGTCAAAGACCTTTGACGAAAATTTTGGCTACCTCAACCCAT
AGGGACCCACAAGCATTTGTTCAAGAAAAACCCCCAAACAAGGCCAAGGACTTGGGAGGGAAGAAACATGGTTCCTTGGGAGAGTTTGGA
CATTGCACTGATCCGTGGAGAAAAACAAAACCCAAGGGCTGGTTTTCGTCTACCCTTTTTTGGTTTAAGGXGAAAAATCTAGGGGGGGCC
CTTGGGTTAACTCAGGGTTGTGGGAAAAAGGGTTCTAACAGGGCTGGCCTTTAgCCGCGGTTACGGAAATGGGAAGGGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan