ESTScan Details for Unigene SGN-U346190

Score 
484
Direction 
Forward
Predicted Peptide Sequence 
IRAIGGQSAEXEESKRLRVDTSEXRETEAEHHQQPPATGDGDSIISLLKSCIKFAGVYGHKMAKDSNTEAALANNTEPEEPTKALQCFDE
AKCKYPTYRHNGPVYSTMINILGRSGRITEMKRTINQMKEDSCECHDSIFVNAIRSYAQAGLTNEAIFLFKSLPEFNCIEWTRSLSTLLE
ILVEESKLESVYQLFLENSCGWEVKSRAHFLNLLMNALCRMKRSDLALHIFQEMSYQNCYPNKESYRILMRGLCEEKRLNEATHLLYSMF
WRISQKGSGEDVVVYRALFEALCENEEREEALQILEGIAKRTKSSEKYYSQIDLTNAGMDQIRKYESFDYXNFEKGIFPVKYSKAWLLTF
PKANDEVTSAQKAEKASTSGDLEKSTALSDARLKHFAYLKGQKRVQINGRDYKLXLKNSWSIFEEFARGGPKKWPVKVVKKLKRGKNFFA
KDILQX
Predicted Coding Sequence 
XATATTAGGGCGATTGGCGGCCAATCGGCCGAAXTTGAAGAGAGTAAGCGGCTGAGGGTTGACACTTCTGAGXTGAGAGAGACTGAGGCT
GAGCACCACCAGCAACCACCGGCGACCGGCGACGGAGATTCCATTATTTCATTATTAAAGAGTTGCATCAAGTTTGCTGGTGTTTATGGG
CATAAGATGGCCAAGGATTCTAACACCGAAGCAGCTCTCGCAAATAATACTGAGCCAGAAGAACCCACAAAAGCGCTTCAATGTTTTGAC
GAAGCAAAATGCAAGTATCCAACTTACCGTCATAATGGTCCTGTTTATAGCACTATGATTAATATTTTGGGCAGATCAGGGAGAATAACT
GAGATGAAGCGAACAATTAATCAGATGAAAGAGGACTCGTGTGAGTGTCATGACTCAATATTTGTGAATGCCATTAGAAGCTATGCGCAA
GCTGGATTAACAAACGAAGCCATTTTTCTTTTTAAGTCTCTTCCGGAGTTCAATTGTATAGAATGGACAAGATCTTTGAGTACTCTTTTG
GAGATATTGGTAGAAGAATCTAAGCTAGAATCTGTTTATCAGTTGTTCCTTGAGAACTCTTGTGGATGGGAAGTGAAGTCTCGGGCACAT
TTCTTGAATTTGTTGATGAATGCTCTTTGTAGAATGAAACGCTCTGATCTTGCATTGCATATTTTCCAAGAGATGAGTTACCAGAACTGC
TATCCAAACAAAGAGAGTTACAGGATCTTGATGAGGGGTTTATGTGAAGAAAAACGGCTCAATGAGGCTACTCATCTATTGTACTCAATG
TTTTGGAGGATATCTCAAAAGGGAAGTGGTGAAGATGTGGTTGTCTATCGAGCTTTATTTGAAGCGTTGTGTGAAAATGAAGAAAGGGAG
GAGGCCTTACAAATCTTGGAAGGTATTGCGAAAAGGACTAAAAGCTCCGAGAAGTACTACAGCCAGATTGATCTTACTAATGCCGGAATG
GATCAAATCCGAAAATATGAAAGTTTTGATTATXTGAACTTTGAAAAAGGCATATTTCCAGTCAAATACTCCAAAGCATGGCTGTTGACT
TTCCCCAAGGCAAATGATGAAGTGACAAGTGCTCAGAAGGCTGAAAAAGCTTCAACCTCGGGGGATTTAGAAAAAAGTACTGCTCTTTCG
GATGCCAGGTTAAAGCATTTTGCTTATTTGAAAGGGCAAAAACGGGTCCAAATTAATGGTAGGGATTATAAGCTTGXTCTGAAAAATTCT
TGGTCTATATTTGAAGAATTTGCAAGAGGTGGGCCAAAAAAATGGCCTGTGAAGGTTGTAAAGAAACTTAAAAGGGGGAAGAATTTCTTT
GCCAAGGATATACTTCAGCXX
Edits in Original Sequence 
(5')XATATTAGGGCGATTGGCGGCCAATCGGCCGAAXTTGAAGAGAGTAAGCGGCTGAGGGTTGACACTTCTGAGXTGAGAGAGACTGA
GGCTGAGCACCACCAGCAACCACCGGCGACCGGCGACGGAGATTCCATTATTTCATTATTAAAGAGTTGCATCAAGTTTGCTGGTGTTTA
TGGGCATAAGATGGCCAAGGATTCTAACACCGAAGCAGCTCTCGCAAATAATACTGAGCCAGAAGAACCCACtAAAAGCGCTTCAATGTT
TTGACGAAGCAAAATGCAAGTATCCAACTTACCGTCATAATGGTCCTGTTTATAGCACTATGATTAATATTTTGGGCAGATCAGGGAGAA
TAACTGAGATGAAGCGAACAATTAATCAGATGAAAGAGGACTCGTGTGAGTGTCATGACTCAATATTTGTGAATGCCATTAGAAGCTATG
CGCAAGCTGGATTAACAAACGAAGCCATTTTTCTTTTTAAGTCTCTTCCGGAGTTCAATTGTATAGAATGGACAAGATCTTTGAGTACTC
TTTTGGAGATATTGGTAGAAGAATCTAAGCTAGAATCTGTTTATCAGTTGTTCCTTGAGAACTCTTGTGGATGGGAAGTGAAGTCTCGGG
CACATTTCTTGAATTTGTTGATGAATGCTCTTTGTAGAATGAAACGCTCTGATCTTGCATTGCATATTTTCCAAGAGATGAGTTACCAGA
ACTGCTATCCAAACAAAGAGAGTTACAGGATCTTGATGAGGGGTTTATGTGAAGAAAAACGGCTCAATGAGGCTACTCATCTATTGTACT
CAATGTTTTGGAGGATATCTCAAAAGGGAAGTGGTGAAGATGTGGTTGTCTATCGAGCTTTATTTGAAGCGTTGTGTGAAAATGAAGAAA
GGGAGGAGGCCTTACAAATCTTGGtAAGGTATTGCGAAAAGGACTAAAAGCTCCGAGAAGTACTACAGCCAGATTGATCTTACTAATGCC
GGAATGGATCAAATCCGAAAATATGAAAGTTTTGATTATXTGAACTTTGAAAAAGGCATATTTCCAGTCAAATACTCCAAAGCATGGCTG
TTGACTTTCCgCCAAGGCAAATGATGAAGTGACAAGTGCTCAGaAAGGCTGAAAAAGCTTCAACCTCGGGGGATTTAGAAAAAAGTACTG
CTCTTTCGGATGCCAGGTTAAAGCATTTTGtCTTATTTGAAAGGGCAAAAACGGGTCCAAATTAATGGTAGGGATTATAAGCTTGXTCTG
AAAAATTCTTGGTCTATATTTGAAGAATTTGCAAGAGGTGGGCCAAAAAAATGGCCTGTGAAGGTTGTAAAGAAACTTAAAcAGGGGGAA
GAATTTCTTTGCCAAGGATATACTTCAGCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan