ESTScan Details for Unigene SGN-U346207

Score 
241
Direction 
Forward
Predicted Peptide Sequence 
GEGGRXXXRLRRMXIMQELHRGGGRSRTSGSPGLQEFGTRLNVHGNHLSGVIPSEVFNISTLQILDLNRNRLTGTLPSSLGLQFPNLQEL
YLGENELTGSIPSSISNASQLATIYMSLNSFTGSIPNLGNLRLLKRLFLAENNLTEGTSKGELKFLSYLTNCRHLETVDVSLNQLNGVLP
SSLGNLSASLQIFSAFGSKIKGTIPVGVGNLTSLTGMYLDSNELTGVIPNTIGKXEKSRRIYLGYNKLEGISHLIFAT
Predicted Coding Sequence 
GGGGAAGGGGGNAGGGNGGNNNAACGATTACGACGCATGANCATCATGCAGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGA
TCCCCCGGGCTGCAGGAATTCGGCACGAGGCTTAACGTCCACGGAAATCACTTGTCAGGTGTCATTCCATCTGAAGTATTCAACATATCG
ACGTTGCAGATTCTAGACTTAAACAGAAACAGGCTCACAGGAACTCTTCCCTCAAGCTTAGGCCTTCAGTTTCCAAATCTGCAAGAGCTT
TATTTAGGTGAGAATGAACTTACAGGATCAATCCCAAGCTCTATCTCAAATGCTTCACAGCTTGCTACTATATACATGTCCCTCAACTCG
TTCACTGGCTCGATACCCAACCTTGGCAATTTAAGACTTTTGAAGAGGCTATTTCTAGCAGAGAATAACCTTACAGAGGGAACTTCCAAA
GGAGAACTAAAATTCTTGTCCTATTTAACAAATTGTAGACATTTGGAAACCGTAGACGTGTCTTTAAATCAGTTAAATGGTGTCCTTCCA
AGTTCATTAGGGAATCTCTCTGCTAGCCTTCAAATTTTCTCAGCATTTGGTAGCAAAATCAAGGGGACCATACCTGTGGGAGTTGGAAAC
TTGACAAGCTTGACCGGTATGTACTTGGATAGCAATGAGTTGACTGGAGTTATCCCGAATACAATTGGAAAGXTTGAGAAATCTCGACGT
ATATATCTTGGATACAATAAACTGGAAGGCATCTCCCACCTGATTTTTGCCACTTGA
Edits in Original Sequence 
(5')GGGGAAGGGGGNAGGGNGGNNNAACGATTACGACGCATGANCATCATGCAGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAG
TGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCTTAACGTCCACGGAAATCACTTGTCAGGTGTCATTCCATCTGAAGTATTCAACAT
ATCGACGTTGCAGATTCTAGACTTAAACAGAAACAGGCTCACAGGAACTCTTCCCTCAAGCTTAGGCCTTCAGTTTCCAAATCTGCAAGA
GCTTTATTTAGGTGAGAATGAACTTACAGGATCAATCCCAAGCTCTATCTCAAATGCTTCACAGCTTGCTACTATATACATGTCCCTCAA
CTCGTTCACTGGCTCGATACCCAACCTTGGCAATTTAAGACTTTTGAAGAGGCTATTTCTAGCAGAGAATAACCTTACAGAGGGAACTTC
CAAAGGAGAACTAAAATTCTTGTCCTATTTAACAAATTGTAGACATTTGGAAACCGTAGACGTGTCTTTAAATCAGTTAAATGGTGTCCT
TCCAAGTTCATTAGGGAATCTCTCTGCTAGCCTTCAAATTTTCTCAGCATTTGGTAGCAAAATCAAGGGGACCATACCTGTGGGAGTTGG
AAACTTGACAAGCTTGACCGGTATGTACTTGGATAGCAATGAGTTGACTGGAGTTATCCCGAATACAATTGGAAAGXTTGAGAAATCTCG
ACGTATATATCTTGGATACAATAAACTGGAAGGCATCTCCCACCTGATTTTTGCCACTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan