ESTScan Details for Unigene SGN-U346439

Score 
400
Direction 
Forward
Predicted Peptide Sequence 
KGGLXPTGPXXLGRXGFNNQRIPRAAGIRHEGHWXDYANKLIGGNCCMRGLRSGERTLVSIARELVMRPHILFIDEPLYHLXQRFCTSDD
GYTEQACHLWLLSDVHHLPNSTEVFGLFDRICLLSNGKTLFFGETLACLQHFSNAGFPCPIMQSPCDHLLRAINTEFDRIIAMCKSWQDN
HGDLSSMSMDTAIAIRTIATSSRLSADAAAAESMIGRLSEKEGSSLQRKGMGGKCYTKLQCFTWENFFAYVKGNGKILLGKNEYLVGVLG
PLQWAQGSSGKGGISFGTR
Predicted Coding Sequence 
XCGAAGGGAGGGTTANCCCCAACTGGACCGNATANGCTGGGACGGNTCGGGTTCAATAACCAGAGGATCCCCCGGGCTGCAGGAATTCGG
CACGAGGGTCACTGGGXTGATTATGCTAATAAACTTATAGGTGGCAACTGTTGCATGAGAGGTCTTCGAAGCGGTGAGAGGACGCTTGTC
AGCATTGCCCGGGAACTTGTTATGAGACCTCATATTTTATTTATTGATGAACCCCTTTATCATCTTGAXCAGCGTTTCTGCACTTCTGAT
GATGGTTACACTGAACAAGCTTGCCACCTCTGGCTGCTCTCTGATGTTCACCATTTGCCAAACAGTACTGAAGTATTTGGCCTTTTTGAC
CGAATTTGCCTCCTCTCAAATGGAAAGACATTGTTTTTTGGTGAAACTTTGGCTTGCTTACAGCACTTCTCGAATGCTGGATTTCCTTGT
CCAATTATGCAAAGTCCTTGTGATCACTTGTTGCGTGCTATAAACACAGAATTTGACAGGATTATTGCGATGTGCAAAAGCTGGCAGGAT
AATCATGGAGACTTATCATCAATGAGCATGGATACTGCCATCGCTATACGTACCATTGCCACATCTTCTAGATTATCAGCAGATGCTGCT
GCCGCTGAATCAATGATAGGGAGGCTTTCTGAAAAAGAAGGTTCATCACTTCAAAGAAAGGGTATGGGCGGGAAATGCTACACAAAATTG
CAGTGTTTTACTTGGGAGAACTTTTTCGCATATGTAAAAGGAAATGGGAAAATATTGTTGGGTAAGAATGAATACCTGGTTGGTGTTCTT
GGCCCTCTTCAATGGGCACAGGGGTCATCCGGGAAAGGGGGCATTTCCTTTGGTACTCGGTAA
Edits in Original Sequence 
(5')XCGAAGGGAGGGTTANCCCCAACTGGACCGNATANGCTGGGACGGNTCGGGTTCAATAACCAGAGGATCCCCCGGGCTGCAGGAAT
TCGGCACGAGGGTCACTGGGXTGATTATGCTAATAAACTTATAGGTGGCAACTGTTGCATGAGAGGTCTTCGAAGCGGTGAGAGGACGCT
TGTCAGCATTGCCCGGGAACTTGTTATGAGACCTCATATTTTATTTATTGATGAACCCCTTTATCATCTTGAXCAGCGTTTCTGCACTTC
TGATGATGGTTACACTGAACAAGCTTGCCACCTCTGGCTGCTCTCTGATGTTCACCATTTGCCAAAgCAGTACTGAAGTATTTGGCCTTT
TTGACCGAATTTGCCTCCTCTCAAATGGAAAGACATTGTTTTTTGGTGAAACTTTGGCTTGCTTACAGCACTTCTCGAATGCTGGATTTC
CTTGTCCAATTATGCAAAGTCCTTGTGATCACTTGTTGCGTGCTATAAACACAGAATTTGACAGGATTATTGCGATGTGCAAAAGCTGGC
AGGATAATCATGGAGACTTATCATCAATGAGCATGGATACTGCCATCGCTATACGTACCATTGCCACATCTTCTAGATTATCAGCAGATG
CTGCTGCCGCTGAATCAATGATAGGGAGGCTTTCTGAAAAAGAAGGTTCATCACTTCAAAGAAAGGGTATGGGCGGGAAATGCTACACAA
AATTGCAGTGTTTTACTTGGGAGAACTTTTTCGCATATGTAAAAGGAAATGGGAAAATATTGTTGGGTAAGAATGAATACCTGGTTGGTG
TTcCTTGGCCCTCTTCAATGGGCACAGGGGTCATCCGGGAAAGGGGGCATTTCCTTTGGTACTCGGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan