ESTScan Details for Unigene SGN-U346484

Score 
-350
Direction 
Reverse
Predicted Peptide Sequence 
RPEAQGFHLRGESGKAPKLGKPPFPRXVGGFINAGGRTGFPIGKGAVSASQLMGVSSLIGPPRLYPLCFRVVCCGELGGDNNFPQETAMP
MITPSWKLPPPKGNKRGGSPAGGAVLEIGDPPGCRNWAGGPKRCLRGPRRRELLGSRVPVRVPVWVSSLRRWGLPTPASFFGGFGXKYPV
KGKPGGIWGCKDWGKVKAGGGLPLDPGRGVTVGGPSEDWGGSPGVRPFVPFGGAG
Predicted Coding Sequence 
AGGCCCGAGGCGCAGGGGTTTCATTTGAGGGGGGAAAGCGGAAAAGCCCCCAAATTGGGAAAACCCCCTTTCCCCCGGGXGGTGGGCGGA
TTCATTAATGCAGGGGGCAGGACAGGTTTCCCGATTGGAAAGGGGGCAGTGAGCGCAAGCCAATTAATGGGAGTTAGCTCCCTCATTGGG
CCCCCCAGGCTTTACCCTTTATGTTTCCGGGTTGTATGTTGTGGGGAATTGGGAGGGGATAACAATTTCCCCCAGGAAACAGCTATGCCC
ATGATTACGCCAAGCTGGAAATTACCCCCCCCTAAAGGGAACAAAAGGGGGGGCTCCCCCGCGGGGGGGGCCGTTTTAGAAATAGGGGAT
CCCCCGGGCTGCAGGAATTGGGCCGGGGGCCCTAAAAGATGTTTAAGGGGCCCAAGAAGGCGGGAATTGTTGGGAAGTAGGGTCCCCGTT
AGGGTGCCAGTTTGGGTAAGCAGTTTAAGAAGATGGGGGTTACCCACCCCAGCAAGTTTTTTTGGGGGTTTTGGGGAXAAGTATCCAGTA
AAGGGGAAACCAGGGGGAATTTGGGGTTGCAAAGATTGGGGCAAAGTAAAAGCCGGXGGGGGTTTACCCCTTGACCCCGGGAGGGGTGTT
ACAGTTGGGGGTCCATCCGAAGACTGGGGGGGCAGCCCGGGAGTTAGACCATTTGTCCCTTTCGGCGGGGCAGGTTAG
Edits in Original Sequence 
CGGGGGCCCTAAAAGATGTTTAAGGGGCCCAAGAAGGCGGGAATTGTTGGGAAGTAGGGTCCCCGTTAGGGTGCCAGTTTGGGTAAGCAG
TTTAAGAAGATGGGGGTTACCCACCCCAGCAAGTTTTTTTGGGGGTTTTGGGGAAAGTATCCAGTAAAGGGGAAACCAGGGGGAATTTGG
GGTTGCAAAGATTGGGGCAAAGTAAAAGCCGGGGGGGTTTACCCCTTGAC
(5')AGGCCCGAGGCGCAGGGGTTTCATTTGAGGGGGGAA
AGCGGAAAAGCCCCCAAATTGGGAAAACCCCCTTTCCCCCGGGXGGTGGGCGGATTCATTAATGCAGGGGGCAGGACAGGTTTCCCGATT
GGAAAGGGGGCAGTGAGCGCAAGCCAATTAATGGGAGTTAGCTCCCTCATTGGGCCCCCCAGGCTTTACCCTTTATGTTTCCGGGTTGTA
TGTTGTGGGGAATTGGGAGGGGATAACAATTTCCCCCAGGAAACAGCTATGCCCATGATTACGCCAAGCTGGAAATTACCCCCCCCTAAA
GGGAACAAAAGGGGGGGCTCCCCCGCGGGGGGGGCCGTTTTAGAAATAGGGGATCCCCCGGGCTGCAGGAATTGGGCCGGGGGCCCTAAA
AGATGTTTAAGGGGCCCAAGAAGGCGGGAATTGTTGGGAAGTAGGGTCCCCGTTAGGGTGCCAGTTTGGGTAAGCAGTTTAAGAAGATGG
GGGTTACCCACCCCAGCAAGTTTTTTTGGGGGTTTTGGGGAXAAGTATCCAGTAAAGGGGAAACCAGGGGGAATTTGGGGTTGCAAAGAT
TGGGGCAAAGTAAAAGCCGGXGGGGGTTTACCCCTTGAcCCCCGGGAGGGGTGTTACAGTTGGGGGTCCaATCCGAAGACTGGGGGGGCA
GCCCGGGAGTTAGACCATTTGTCCCTTTCGGCGGGGCAGGTTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan