ESTScan Details for Unigene SGN-U346572

Score 
289
Direction 
Forward
Predicted Peptide Sequence 
EMINQVLSHLSGLSDQGQTPPVFPVPAPQVPGVQHAAVVALRMDASLEIGTFPRLTTGPIMTSDQHELFTKFLKLKPLVFKGAESEDAYD
FLVDCHELLHKMDIVERFGVEFVPINFREMSKCGGGRMLSVNQHSTTYDLGIIXLAYLWKSVYPXTLRDRRRDXVPESMQGRMSVTAYEA
KFCALSRYATQLCFSPQERIHRFVKGLRSDLQIPALQVAACSKFFQEVVDFMIEVEGVKSEYFHMASTSKKVRTGGEFSDSYSKGKKFRR
NQLDLFVFTTGEGRGAIPDHPTFPTPGGKAGKMKKGKGLALEFWGEKPLETDKSKNGKIKEFWEKMVFQISKLKGRKN
Predicted Coding Sequence 
GAGATGATCAACCAGGTTCTTTCTCATCTTAGCGGGTTATCTGATCAGGGCCAGACACCTCCAGTGTTTCCTGTACCAGCACCTCAGGTT
CCGGGAGTACAACATGCAGCTGTTGTGGCTCTCCGCATGGATGCCTCATTGGAAATAGGCACATTTCCTCGATTGACTACAGGGCCTATA
ATGACGAGTGATCAACATGAACTTTTCACTAAATTCTTGAAGTTGAAACCTCTAGTCTTCAAGGGTGCTGAATCTGAGGATGCCTATGAT
TTTCTTGTTGATTGTCATGAGCTGCTACATAAGATGGACATAGTAGAACGGTTCGGGGTTGAGTTTGTGCCTATCAATTTCAGGGAAATG
TCAAAATGTGGTGGCGGTCGTATGTTGAGTGTCAACCAGCACAGCACCACCTATGACTTGGGCATCATTXCTCTAGCTTATTTATGGAAA
AGTGTATACCCCGXGACGTTGAGGGATAGGAGGAGAGATGAXGTTCCTGAGTCTATGCAAGGCAGGATGTCTGTTACTGCTTATGAGGCT
AAATTTTGTGCACTATCCAGGTATGCCACCCAGCTTTGCTTCAGTCCACAAGAGCGGATTCACCGTTTTGTGAAAGGATTGAGGTCAGAT
TTGCAGATCCCAGCCCTACAGGTAGCTGCNTGCAGCAAATTCTTTCAGGAAGTGGTTGACTTTATGATAGAGGTGGAGGGGGTGAAATCA
GAATACTTTCACATGGCGTCGACCTCTAAGAAAGTCCGCACGGGAGGTGAGTTTAGTGATTCATACTCCAAAGGGAAGAAGTTCAGGAGG
AACCAGCTCGACCTATTTGTCTTTACTACCGGTGAAGGTAGGGGXGCCATCCCAGACCATCCAACATTCCCTACTCCTGGGGGGAAAGCT
GGTAAAATGAAAAAGGGAAAAGGCCTTGCCTTGGAATTTTGGGGGGAAAAACCTCTGGAAACTGATAAATCTAAAAATGGTAAGATCAAA
GAATTCTGGGAAAAAATGGTTTTCCAAATTTCGAAACTAAAGGGTAGGAAAAACTGA
Edits in Original Sequence 
GAGATGATCAACCAGGTTCTTTCTCATCTTAGCGGGTTATCTGATCAGGGCCAGACACCTCCAGTGT(5')GAGATGATCAACCAGGTTC
TTTCTCATCTTAGCGGGTTATCTGATCAGGGCCAGACACCTCCAGTGTTTCCTGTACCAGCACCTCAGGTTCCGGGAGTACAACATGCAG
CTGTTGTGGCTCTCCGCATGGATGCCTCATTGGAAATAGGCACATTTCCTCGATTGACTACAGGGCCTATAATGACGAGTGATCAACATG
AACTTTTCACTAAATTCTTGAAGTTGAAACCTCTAGTCTTCAAGGGTGCTGAATCTGAGGATGCCTATGATTTTCTTGTTGATTGTCATG
AGCTGCTACATAAGATGGACATAGTAGAACGGTTCGGGGTTGAGTTTGTGaCCTATCAATTTCAGGGAAATGTCAAAATGTGGTGGCGGT
CGTATGTTGAGTGTCAACCAGCACAGCACCACCTATGACTTGGGCATCATTXCTCTAGCTTATTTATGGAAAAGTGTATACCCCGXGACG
TTGAGGGATAGGAGGAGAGATGAXGTTCCTGAGTCTATaGCAAGGCAGGATGTCTGTTACTGCTTATGAGGCTAAATTTTGTGCACTATC
CAGGTATGCCACCCAGCTTTGCTTCAGTCCACAAGAGCGGATTCACCGTTTTGTGAAAGGATTGAGGTCAGATTTGCAGATCCCAGCCCT
ACAGGTAGCTGCNTGCAGCAAATTCTTTCAGGAAGTGGTTGACTTTATGATAGAGGTGGAGGGGGTGAAATCAGAATACTTTCACATGGC
GTCGACCTCTAAGAAAGTCCGCACGGGAGGTGAGTTTAGTGATTCATACTCCAAAGGGAAGAAGTTCAGGAGGtAACCAGCTCGACCTAT
TTGTCTTTACTACCgGGTGAAGGTAGGGGXGCCATCCCAGACCATCCAACATTCCCTACTCCTGGGGGGAAAGCTGGTAAAATGAAAAAG
GGAAAAGGCCTTGCCTTGGAATTTTGGGGGGAAAAACCTCTGGAAACTGATAAATCTAAAAATGGTAAGATCAAAGAATTCTGGGAAAAA
ATGGTTTTCCAAATTTCGAAACTAAAGGGTAGGAAAAACTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan