Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U346599

Score 
505
Direction 
Forward
Predicted Peptide Sequence 
LQKLILANNFLTGTIPNELVSLPNLKEFDISNNLIYGKIPPFKSNVLVKYDGNVNIGKDNPPPFAPSGSTPSSPDGGGQTHGNGNKKSST
GVVVGSVIGGVCGAVAIAGLFVFCLYRTKRMRSGRVQSPHTVVIHPHHSGSDQDAVKITVAGSSVNGGTTESTVVEAXAPGDLHIVEAGN
MVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKEMESGVMSKRGWDEFTSENAVLTKVRPKPXGGTARIMLGWKIEGTX
Predicted Coding Sequence 
TTACAAAAGTTGATCCTAGCAAATAATTTTCTTACTGGAACTATTCCGAATGAGCTCGTTTCGCTGCCAAACCTAAAGGAATTTGATATT
TCTAACAATCTAATTTATGGGAAAATCCCACCATTTAAGAGCAATGTATTGGTTAAATATGATGGCAATGTCAATATTGGGAAAGATAAT
CCACCTCCTTTTGCACCTTCCGGGAGCACTCCTAGTTCACCCGATGGAGGTGGACAAACTCATGGGAATGGTAATAAAAAATCTTCAACT
GGAGTTGTTGTGGGCTCAGTGATAGGTGGTGTTTGTGGTGCCGTTGCGATTGCTGGATTATTTGTGTTTTGTCTTTACAGGACTAAGCGT
ATGCGGTCCGGTAGAGTTCAGAGTCCACACACAGTTGTTATTCATCCTCATCATTCAGGATCTGACCAAGATGCTGTTAAGATCACAGTT
GCTGGTTCAAGTGTCAATGGAGGGACAACTGAAAGCACAGTTGTGGAAGCAGXTGCACCTGGGGACTTGCACATTGTTGAGGCTGGTAAC
ATGGTGATTTCCATCCAAGTTTTGAGGAATGTCACGAACAACTTCAGCGAGGAGAATATATTGGGGAGAGGTGGATTTGGAACTGTTTAC
AAAGGGGAGTTGCATGATGGAACTAAAATTGCTGTTAAAGAAATGGAATCTGGTGTTATGAGCAAAAGGGGTTGGGATGAATTTACGTCT
GAAAATGCGGTGCTTACTAAAGTCCGNCCCAAGCCTXTTGGTGGCACTGCTAGGATAATGCTTGGATGGAAAATAGAAGGTACTTXX
Edits in Original Sequence 
GGTCGTTACAAAAGTTGATCCTAGCAAATAATTTTCTTACTGGAACTATTCCGAATGAGCTCGTTTCGCTGCCAAACCTAAAGGAATTTG
ATATTTCTAACA
(5')TTACAAAAGTTGATCCTAGCAAATAATTTTCTTACTGGAACTATTCCGAATGAGCTCGTTTCGCTGCCAAACCT
AAAGGAATTTGATATTTCTAACAATCTAATTTATGGGAAAATCCCACCATTTAAGAGCAATGTATTGGTTAAATATGATGGCAATGTCAA
TATTGGGAAAGATAATCCACCTCCTTTTGCACCTTCCGGGAGCACTCCTAGTTCACCCGATGGAGGTGGACAAACTCATGGGAATGGTAA
TAAAAAATCTTCAACTGGAGTTGTTGTGGGCTCAGTGATAGGTGGTGTTTGTGGTGCCGTTGCGATTGCTGGATTATTTGTGTTTTGTCT
TTACAGGACTAAGCGTATGCGGTCCGGTAGAGTTCAGAGTCCACACACAGTTGTTATTCATCCTCATCATTCAGGATCTGACCAAGATGC
TGTTAAGATCACAGTTGCTGGTTCAAGTGTCAATGGAGGGACAACTGAAAcGCACAGTTGTGGAAGCAGXTGCACCTGGGGACTTGCACA
TTGTTGAGGCTGGTAACATGGTGATTTCCATCCAAGTTTTGAGGAATGTCACGAACAACTTCAGCGAGGAGAATATATTGGGGAGAGGTG
GATTTGGAACTGTTTACAAAGGGGAGTTGCATGATGGAACTAAAATTGCTGTTaAAAGAAATGGAATCTGGTGTTATGAGCgAAAAGGGG
TTGGGATGAATTTACGTCTGAAAATGCGGTGCTTACTAAAGTCCGNCCCAAGCCTXTTGGTGGCACTGCTAGGATAATGCTTGGATGGAA
AATAGAAGGTACTTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan