ESTScan Details for Unigene SGN-U346605

Score 
381
Direction 
Forward
Predicted Peptide Sequence 
RVXXXXXTNSNGNPHGGXRRSSGYTRAAGIRHEEPKIVRPIFDNPFLKIQELPGNTVKRNSESLKQANCDPKGTSLVVTRDVDLDTAENT
WLRLYVPRRLTKNPNPKKLPLIMYYHGGGFVYFHANTFIFDVFCQALAERVGAMVISLEYRLAPEHRLPAAYDDAMDGLEWLKNTKDEWV
CNYADLSKVFLGGTSSGGNLAYNAGLRAGRDGKRARANKDQRFTITLSIFQWENRTESEEKPKDDQLLPLGGQKQNVPFMLTKKEWIMNM
RSAIHVLKGDPNXLNGMKEIRMGRGLVRGLVKDPLGDGG
Predicted Coding Sequence 
XXNAGGGTGGNNNCGTTNNNNNCCACAAACTCTAACGGCAACCCTCATGGAGGAXCGCGGAGAAGTTCGGGATACACCCGGGCTGCAGGA
ATTCGGCACGAGGAGCCAAAGATTGTTCGTCCAATTTTTGACAATCCTTTTCTTAAGATTCAAGAATTACCAGGTAACACAGTTAAACGT
AACTCTGAATCCCTCAAACAAGCCAATTGTGATCCAAAAGGCACATCATTAGTCGTAACAAGGGATGTTGATCTTGACACAGCAGAAAAC
ACTTGGCTGCGACTATACGTCCCAAGACGTTTGACAAAAAATCCAAATCCTAAGAAATTGCCACTGATTATGTACTATCACGGGGGAGGC
TTTGTTTATTTCCATGCCAATACTTTTATATTCGATGTGTTTTGCCAGGCACTTGCTGAAAGAGTTGGTGCTATGGTGATTTCACTTGAA
TATCGTCTAGCCCCTGAACATCGCCTTCCTGCTGCTTATGATGATGCTATGGATGGGTTAGAATGGCTTAAGAATACCAAGGATGAATGG
GTTTGTAATTATGCTGATTTGAGTAAAGTTTTTCTTGGTGGAACTAGTTCTGGAGGAAATTTAGCTTATAATGCAGGGCTACGTGCXGGC
AGGGATGGCAAAAGAGCTAGAGCCAATAAAGATCAAAGGTTTACTATTACATTATCCATTTTTCAGTGGGAAAACAGAACAGAATCCGAG
GAAAAGCCGAAAGATGATCAACTTCTACCACTTGGTGGXCAGAAACAAAATGTTCCATTTATGCTTACCAAAAAGGAGTGGATCATGAAC
ATGAGATCTGCAATCCATGTGCTTAAGGGAGATCCAAACAXTTTAAATGGGATGAAAGAAATTAGGATGGGAAGGGGTTTGGTAAGGGGG
CTTGTGAAAGATCCACTCGGTGATGGCGGX
Edits in Original Sequence 
(5')XXNAGGGTGGNNNCGTTNNNNNCCACgAAACTCTAACGGCAACCCTCATGGAGGAXCGCGGAGAAGTTCGGGATACACCCGGGCTG
CAGGAATTCGGCACGAGGAGCCAAAGATgTGTTCGTCCAATTTTTGACAATCCTTTTCTTAAGATTCAAGAATTACCAGGTAACACAGTT
AAACGTAACTCTGAATCCCTCAAACAAGCCAATTGTGATCCAAAAGGCACATCATTAGTCGTAACAAGGGATGTTGATCTTGACACAGCA
GAAAACACTTGGCTGCGACTATACGTCCCAAGACGTTTGACAAAAAATCCAAATCCTAAGAAATTGCCACTGATTATGTACTATCACGGG
GGAGGCTTTGTTTATTTCCATGCCAATACTTTTATATTCGATGTGTTTTGCCAGGCACTTGCTGAAAGAGTTGGTGCTATGGTGATTTCA
CTTGAATATCGTCTAGCCCCTGAACATCGCCTTCCTGCTGCTTATGATGATGCTATGGATGGGTTAGAATGGCTTAAGAATACCAAGGAT
GAATGGGTTTGTAATTATGCTGATTTGAGTAAAGTTTTTCTTGGTGGAACTAGTTCTGGAGGAAATTTAGCTTATAATGCAGGGCTACGT
GCXGGCAGGGATGGCAAAAGAGCTAGAGCCAATAAAGATCAAAGGTTTACTATTACATTATCCATTTTTCAGTGGGtAAAACAGAACAGA
ATCCGAGGAAAAGCCGAAAGATGATCAACTTCTACCACTTGGTGGXCAGAAACAAAATGTTCCATTTATGCTTACCAAAAAGGAGTGGAT
CATGAACATGAGATCTGCAATCCATGTGCTTAAGGGAGATCCAAACAXTTTAAATGGGATGAAAGAAATTAGGATGGGAAGGGGTTTGGT
AAGGGGGCTTGTGAAAGATCCACTCGGTGATGGCGGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan