ESTScan Details for Unigene SGN-U346618

Score 
434
Direction 
Forward
Predicted Peptide Sequence 
MESEPGDQHYASLVDFSAELENYKRQTQVIENMPMEPTQSVWGALLTGCIIHKNTELAAYVADRVLELRPEAQAYMCCCPHAYAAAGDMN
XAAKATKMLIDIGVKKETGLSWVEEGNKEHTFAAGDRSHSKSKEIYEKLDELREHMEQAGYVAYNNYVLQQVAGQENSETIMYHNERLAI
AFALITFPPERPIRIMKYLRVCGDCHNADKDYFIVHQDSSYRSGQRSDFIALRMRNAPEVTTDD
Predicted Coding Sequence 
ATGGAGTCTGAGCCAGGGGACCAACATTATGCTTCTCTTGTGGACTTCTCGGCCGAGCTGGAAAATTACAAGAGGCAGACTCAAGTCATT
GAGAACATGCCGATGGAACCAACACAATCTGTTTGGGGAGCTTTGTTGACTGGCTGTATAATCCACAAGAACACTGAATTGGCAGCTTAT
GTGGCCGACAGGGTCCTTGAGTTAAGGCCTGAAGCTCAGGCTTACATGTGCTGCTGTCCACACGCATATGCTGCTGCTGGAGATATGAAT
AXGGCTGCTAAAGCTACGAAGATGCTCATAGACATAGGTGTGAAAAAGGAAACTGGTTTGAGTTGGGTTGAGGAGGGAAATAAAGAACAC
ACATTTGCTGCTGGAGATCGGTCTCACTCAAAGTCGAAGGAGATATATGAAAAGTTGGATGAATTACGCGAACACATGGAGCAAGCTGGG
TATGTTGCATACAACAATTATGTGTTGCAACAGGTTGCTGGCCAGGAAAACAGTGAGACTATCATGTATCATAACGAAAGACTAGCCATT
GCTTTCGCCCTTATCACCTTTCCACCGGAAAGGCCTATTAGAATTATGAAATACTTGCGTGTATGTGGCGACTGTCACAATGCXGATAAA
GATTATTTCATAGTGCACCAAGACAGTAGTTATCGTAGTGGACAACGATCXGATTTCATCGCTTTGAGGATGAGAAATGCTCCTGAGGTG
ACTACTGATGACTGA
Edits in Original Sequence 
TTTATGAGTGCTATATGCTCTGTACCCATGCTGGGCTGGTCCCAAAAGGGAAATTTTACTTTGATTTAATGAACACACACATGGAGTCTG
AGCCAGGGGACCAACATTATGCTTCTCTTGTGGACTGTCTCGGCCGAGCTGGAAAATTACAAGA
(5')ATGGAGTCTGAGCCAGGGGACC
AACATTATGCTTCTCTTGTGGACTgTCTCGGCCGAGCTGGAAAATTACAAGAGGCAGACTCAAGTCATTGAGAACATGCCGATGGAACCA
ACACAATCTGTTTGGGGAGCTTTGTTGACTGGCTGTATAATCCACAAGAACACTGAATTGGCAGCTTATGTGGCCGACAGGGTCCTTGAG
TTAAGGCCTGtAAGCTCAGGCTTACATGTGCTGCTGTCCACACGCATATGCTGCTGCTgGGAGATATGAATAXGGCTGCTAAAGCTACGA
AGATGCTCATAGACATAGGTGTGAAAAAGGAAACTGGTTTGAGTTGGGTTGAGGAGGGAAATAAAGAACACACATTTGCTGCTGGAGATC
GGTCTCACTCAAAGTCGAAGGAGATATATGAAAAGTTGGATGAATTACGCGAACACATGGAGCAAGCTGGGTATGTTGCATACAcACAAT
TATGTGTTGCAACAGGTTGCTGGCCAGGAAAACAGTGAGACTATCATGTATCATAACGAAAGACTAGCCATTGCTTTCGCCCTTATCACC
TTTCCACCGGAAAGGCCTATTAGAATTATGAAATACTTGCGTGTATGTGGCGACTGTCACAATGCXGATAAAGATTATTTCATAGTGCAC
CAAGACAGTAGTTATCGTAGTGGACAACGATCXGATTTCATCGCTTTGAGGATGAGAAATGCTCCTGAGGTGACTACTGATGACTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan