ESTScan Details for Unigene SGN-U346669

Score 
590
Direction 
Reverse
Predicted Peptide Sequence 
PEKKXEGXCSSKTKVSKSIEEIEKATDXYNEDEHFEDDDQKIVKSLRVSCWLNGAAACLKQSYFQEAIKQCCKVLEVESCNVKALYRRAQ
AFMETADLHLAELDIKKALAIEPQNREVKLIQKTLKQLQSESNKRDAKLYTTMFARLSNENSSAAKKLKVEETESKNEENVGEINXALTF
NWKLNLDEESVLVYIFSKADRXLDPGVYRKQPLYSTYPVKVGVRSVYTPPFLDVTCFGEYIGYVVNASMYSQGNRERLSIQGTTLVPLEI
AGFQFILNVKIW
Predicted Coding Sequence 
CCAGAGAAGAAGANNGAAGGCANCTGCTCTTCAAAAACGAAAGTTTCAAAGAGCATTGAAGAAATCGAGAAGGCTACTGATXTGTATAAT
GAAGATGAACATTTTGAAGATGATGATCAAAAGATAGTTAAATCATTGAGAGTGTCATGCTGGTTGAATGGTGCTGCTGCTTGTCTCAAA
CAGAGTTATTTCCAGGAAGCAATCAAGCAATGTTGCAAGGTCTTAGAAGTTGAATCCTGCAATGTGAAAGCATTATATAGGAGAGCGCAA
GCATTTATGGAAACAGCTGATCTGCACTTGGCTGAACTGGATATCAAGAAGGCACTAGCAATAGAGCCACAAAACAGGGAGGTGAAACTG
ATACAGAAGACACTAAAACAACTCCAATCAGAGAGCAACAAGAGAGACGCAAAGCTCTATACAACAATGTTTGCACGCTTATCAAATGAG
AACTCTTCTGCAGCAAAGAAATTAAAAGTTGAGGAAACGGAGAGCAAGAATGAAGAAAATGTTGGTGAAATCAACAXTGCACTGACATTT
AATTGGAAGTTGAATCTAGATGAAGAATCXGTACTTGTATACATATTTTCTAAAGCTGACAGAGXTCTTGATCCAGGAGTCTACAGGAAA
CAACCTCTTTACTCCACTTACCCTGTAAAGGTAGGGGTAAGGTCTGTGTACACCCCACCCTTTCTAGATGTCACTTGTTTTGGXGAATAT
ATTGGGTATGTTGTTAACGCGAGCATGTATAGCCAAGGTAATAGAGAAAGGCTTTCCATCCAAGGAACCACACTTGTACCTCTGGAAATA
GCTGGTTTTCAGTTCATTTTAAATGTAAAAATTTGG
Edits in Original Sequence 
(5')CCAGAGAAGAAGANNGAAGGCANCTGCTCTTCAAAAACGAAAGTTTCAAAGAGCATTGAAGAAATCGAGAAGGCTACTGATXTGTA
TAATGAAGATGAACATTTTGAAGATGATGATCAAAAGATAGTTAAATCATTGAGAGTGTCATGCTGGTTGAATGGTGCTGCTGCTTGTCT
CAAACAGAGTTATTTCCAGGAAGCAATCAAGCAATGTTGCAAGGTCTTAGAAGTTGAATCCTGCAATGTGAAAGCATTATATAGGAGAGC
GCAAGCATTTATGGAAACAGCTGATCTGCACTTGGCTGAACTGGATATCAAGAAGGCACTAGCAATAGAGCCACAAAACAGGGAGGTGAA
ACTGATACAGAAGACACTAAAACAACTCCAATCAGAGAGCAACAAGAGAGACGCAAAGCTCTATACAACAATGTTTGCACGCTTATCAAA
TGAGAACTCTTCTGCAGCAAAGAAATTAAAAGTTGAGGAAACGGAGAGCAAGAATGAAGAAAATGTTGGTGAAATCAACAXTGCACTGAC
ATTTAATTGGAAGTTGAATCTAGATGAAGAATCXGTACTTGTATACATATTTTCTAAAGCTGACAGAGXTCTTGATCCAGGAGTCTACAG
GAAACAACCTCTTTACTCCACTTACCCTGTAAAGGTAGGGGTAAGGTCTGTGTACACCCCACCCTTTCTAGATGTCACTTGTTTTGGXGA
ATATATTGGGTATGTTGTTAACGCGAGCATGTATAGCCAAGGTAATAGAGAAAGGCTTTCCATCCAAGGAACCACACTTGTACCTCTGGA
AATAGCTGGTTTTCAGTTCtATTTTAAATGTAAAAATTTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan