ESTScan Details for Unigene SGN-U346705

Score 
-572
Direction 
Reverse
Predicted Peptide Sequence 
YTLKAPESATLSRGGVGVYAQGDPNFCKAALGPAPFAFFPSLSRQVWGFPPVSFNSGAPFRVXILVLYGPDPKKLIRLGVPKGPSPEXGG
FSPFDVGATFFNSGLLFQIGPTLNPIWSILLIYKDFADLAYWLKNELINKNLTRILQNINAYNLPFAIQAAQLLGRAIGAGLFAITPAGE
RGMCCKAIKLGNARVFPVTTL
Predicted Coding Sequence 
XGGTACACCCTGAAGGCCCCCGAAAGCGCAACATTAAGCCGGGGGGGTGTGGGTGTTTACGCACAGGGTGACCCTAACTTTTGCAAGGCX
GCCCTAGGGCCCGCTCCCTTTGCTTTTTTTCCTTCCCTTTCTCGCCAGGTTTGGGGGTTTCCXCCGGTAAGTTTTAATTCGGGGGCCCCC
TTTAGGGTTCXGATTTTAGTGCTTTACGGCCCTGACCCCAAAAAACTTATTAGGTTAGGGGTTCCGAAGGGGCCCTCCCCTGAAXTAGGC
GGTTTTTCGCCCTTTGACGTTGGAGCCACGTTCTTTAATAGTGGACTCTTGTTCCAAATTGGACCAACACTCAACCCTATCTGGTCTATT
CTTTTGATTTATAAGGATTTTGCCGATTTGGCCTATTGGTTAAAAAATGAGCTGATTAACAAAAATTTAACGCGAATTTTACAAAATATT
AACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGC
GAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAA
Edits in Original Sequence 
(5')XGGTACACCCTGAAGGcCCCCCGAAAGCGCAACATTAAGCCGGGGGGGTGTGGGTGTTTACGCACAGGGTGACCCTAACTTTTGCA
AGGCXGCCCTAGGGCCCGCTCCCTTTGCTTTTTTTCCTTCCCTTTCTCGCCAGGTTTGGGGGTTTCCXCCGGTAAGTTTTAATTCGGGGG
CCCCCTTTAGGGTTCXGATTTTAGTGCTTTACGGCCCTGAcCCCCAAAAAACTTATTAGGTTAGGGGTTCCGAAGGGGCCCTCCCCTGAA
XTAGGCGGTTTTTCGCCCTTTGACGTTGGAGtCCACGTTCTTTAATAGTGGACTCTTGTTCCAAATTGGACCAACACTCAACCCTATCTc
GGTCTATTCTTTTGATTTATAAgGGATTTTGCCGATTTcGGCCTATTGGTTAAAAAATGAGCTGAtTTAACAAAAATTTAACGCGAATTT
TaACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATT
ACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan