ESTScan Details for Unigene SGN-U346706

Score 
459
Direction 
Forward
Predicted Peptide Sequence 
GGXXSXGXTDSLAIRIGARSRTRGSLGLQEFGXEASLKKEEEEEDKRILECRTIIFGVILGIPNNYFRKAGKRIPPHIVKALNFSDTXTM
GDLHSAEEHGITQISAVIFDLDGTLLSTEHLTKEILKEFLAGYGKVPDKEKEKKRLGMAHKEYAIGIVSDYDLPITPDQYVQAVMPFYHD
LWLQAKALPGANRLIRHFHKHGVPFALASNSKRKNIDKKVSLQEGWKECFSIVLGSDEVKSWKPSPDIFLKLQNKWVQKQVNAXMIEDSG
IGIKAAKAAWIEGGSWGHFSIL
Predicted Coding Sequence 
XGGGGAGGCTTNNNCTCNNCNGGNNTTACTGATTCTCTTGCTATCCGTATAGGCGCCCGTTCTAGAACTCGTGGATCCCTCGGGCTGCAG
GAATTCGGCXACGAGGCATCACTCAAAAAGGAAGAAGAAGAAGAAGACAAGAGGATATTGGAATGTAGAACAATAATATTTGGTGTTATA
CTTGGAATACCGAATAATTACTTTCGGAAGGCGGGAAAAAGAATCCCTCCCCATATTGTCAAAGCCTTAAACTTCTCTGACACAXCAACA
ATGGGGGATCTTCATTCTGCAGAAGAACATGGAATAACTCAAATTTCAGCTGTCATTTTTGATTTGGATGGTACCCTTTTGAGTACAGAG
CACTTGACAAAGGAAATTCTGAAGGAATTTCTGGCTGGATACGGGAAGGTGCCAGATAAGGAGAAGGAAAAGAAAAGATTGGGGATGGCC
CACAAAGAGTACGCTATTGGCATTGTCAGTGATTACGACCTCCCTATCACGCCCGATCAGTATGTCCAAGCTGTCATGCCCTTTTATCAT
GACTTGTGGTTGCAAGCAAAAGCGCTTCCTGGTGCTAATCGCCTTATAAGACATTTCCATAAGCATGGAGTTCCCTTTGCCCTTGCTTCA
AATTCCAAAAGGAAAAACATAGATAAGAAAGTCTCTCTCCAAGAAGGTTGGAAAGAATGTTTTTCCATAGTTCTTGGAAGTGACGAGGTT
AAATCATGGAAGCCTTCTCCAGACATTTTCTTGAAGCTGCAGAACAAATGGGTGCAGAAGCAAGTTAATGCTXTTATGATAGAGGATTCT
GGTATCGGAATCAAGGCAGCAAAGGCTGCTTGGATTGAAGGGGGTAGCTGGGGCCATTTTTCCATTCTT
Edits in Original Sequence 
(5')XGGGGAGGCTTNNNCTCNNCNGGNNTTACTGATTCTCTTGCTATCCGTATAGGCGCCCGTTCTAGAACTCGTGGATCCCTCGGGCT
GCAGGAATTCGGCXACGAGGCATCACTCAAAAAGGAAGAAGAAGAAGAAGACAAGAGGATATTGGAATGTAGAACAATAATATTTGGTGT
TATACTTGGAATACCGAATAATTACTTTCGGAAGGCGGGAAAAAGAATCCCTCCCCATATTGTCAAAGCCTTAAACTTCTCTGACACAXC
AACAATGGGGGATCTTCATTCTGCAGAAGAACATGGAATAACTCAAATTTCAGCTGTCATTTTTGATTTGGATGGTACCCTTTTGAGTAC
AGAGCACTTGACAAAGGAAATTCTGAAGGAATTTCTGGCTGGATACGGGAAGGTGCCAGATAAGGAGAAGGAAAAGAAAAGATTGGGGAT
GGCCCACAAAGAGTACGCTATTGGCATTGTCAGTGATTACGACCTCCCTATCACGCCCGATCAGTATGTCCAAGCTGTCATGCCCTTTTA
TCATGACTTGTGGTTGCAAGCAAAAGCGCTTCCTGGTGCTAATCGCCTTATAAGACATTTCCATAAGCATGGAGTTCCCTTTGCCCTTGC
TTCAAATTCCAAAAGGAAAAACATAGATAAGAAAGTCTCTCTCCAAGAAGGTTGGAAAGAATGTTTTTCCATAGTTCTTGGAAGTGACGA
GGTTAAATCATGGAAGCCTTCTCCAGACATaTTTCTTGAAGCTGCAGAACAAATGGGTGCAGAAGCAAGTTAATGCTXTTATGATAGAGG
ATTCTGGTATCGGAATCAAGGCAgGCAAAGGCTGCTTGGATTGAAGGGGGTAGCTGGGGCCATTTTTCCATTCTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan