Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U346728

Score 
546
Direction 
Forward
Predicted Peptide Sequence 
MREEYNLEPSMDHYGAMVDLIGRAGRLSEAWNFIDNMPTRPGLNVYGAMLGACKIHKNVELGEKAADKLFELDPDDGGYHVLLANMYATA
SIWHKVANVRTMMERKGIQKTPGWSLVDLRNEVHTFYSGSTSHPQSEKIYAYLEKLFDRIKAAGYIPDTNSIHDVEDVVQKQLLKSHSEK
LAIAFGLLNTSAGTTIPIRKNLRVCGDCHTATKYISLVMKREIIVRDMHRFHHFKGWSVFMVEITGGYERSNTSPPLVTSFNLRKNL
Predicted Coding Sequence 
ATGAGGGAAGAATACAACTTGGAGCCTTCAATGGACCATTATGGGGCAATGGTTGACCTAATTGGTCGAGCTGGTCGGCTGAGTGAGGCT
TGGAACTTCATTGATAATATGCCTACCAGACCAGGACTCAATGTCTATGGTGCAATGTTGGGAGCTTGCAAGATTCACAAAAATGTAGAA
TTGGGGGAGAAGGCAGCAGACAAACTATTTGAGCTAGATCCCGATGATGGTGGATATCATGTGCTTCTTGCTAATATGTACGCCACGGCT
TCAATATGGCATAAAGTTGCTAATGTCAGAACTATGATGGAGAGAAAAGGTATTCAAAAGACACCTGGATGGAGTCTAGTTGATTTAAGA
AACGAGGTCCACACATTCTACTCAGGAAGCACTAGCCATCCTCAGTCAGAGAAGATCTATGCTTACCTTGAGAAACTGTTTGATAGGATT
AAAGCTGCTGGATATATACCTGATACTAATTCAATTCACGATGTGGAAGATGTTGTTCAGAAGCAACTGCTAAAGAGCCACAGTGAGAAG
CTTGCTATTGCATTTGGTCTTTTAAATACGAGTGCTGGTACAACTATTCCCATCAGGAAAAATCTCCGGGTTTGTGGTGACTGCCATACT
GCAACAAAGTACATCTCGCTTGTCATGAAACGAGAAATTATTGTACGTGATATGCACCGTTTCCACCATTTTAAGGGATGGAGTGTGTTC
ATGGTGGAGATTACTGGGGGATATGAAAGATCAAATACTTCTCCXCCATTGGTAACCTCCTTTAACCTCCGTAAAAACCTX
Edits in Original Sequence 
ACGATCATGAGGGAAGAATACAACTTGGAGCCTTCAATGGACCATTATGGGGCAATGGTTGACCTAATTGGTCGAGCTGGTCGGCTGAGT
GAGGCTTGGAACTTCATTGATAATATGCCTACCAGACCAGGACTCAATGTCTA
(5')ATGAGGGAAGAATACAACTTGGAGCCTTCAATG
GACCATTATGGGGCAATGGTTGACCTAATTGGTCGAGCTGGTCGGCTGAGTGAGGCTTGGAACTTCATTGATAATATGCCTACCAGACCA
GGACTCAATGTCTATGGTGCAATGTTGGGAGCTTGCAAGATTCACAAAAATGTAGAATTGGGGGAGAAGGCAGCAGACAAACTATTTGAG
CTAGATCCCGATGATGGTGGATATCATGTGCTTCTTGCTAATATGTACGCCACGGCTTCAATATGGCATAAAGTTGCTAATGTCAGAACT
ATGATGGAGAGAAAAGGTATTCAAAAGACACCTGGATGGAGTCTAGTTGATTTAAGAAACGAGGTCCACACATTCTACTCAGGAAGCACT
AGCCATCCTCAGTCAGAGAAGATCTATGCTTACCTTGAGAAACTGTTTGATAGGATTAAAGCTGCTGGATATATACCTGATACTAATTCA
ATTCACGATGTGGAAGATGTTGTTCAGAAGCAACTGCTAAAGAGCCACAGTGAGAAGCTTGCTATTGCATTTGGTCTTTTAAATACGAGT
GCTGGTACAACTATTCCCATCAGGAAAAATCTCCGGGTTTGTGGTGACTGCCATACTGCAACAAAGTACATCTCGCTTGTCATGAAACGA
GAAATTATTGTACGTGATATGCACCGTTTCCACCATTTTAAGGGATGGAGTGTGTTCATGGTGGAGATTACTGGGGGATATGAAAGATCA
AATACTTCTCCXCCATTGGTAACCTCCTTTAACCTCCGTAAAAACCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan