ESTScan Details for Unigene SGN-U346802

Score 
330
Direction 
Reverse
Predicted Peptide Sequence 
MALRVLLHRFIFPTVXGTDFYIDLKKVEEDNQXHVXLSQALRVFTRGANRRLVQDIVLKVAKYLNNGDIALAPAPAPPPSPLDCGGFANT
DAVYTRGPMCVLGHVEHVVLGANXVPPGTFGNRDKCGKCYTEMTTHGNKTKCP
Predicted Coding Sequence 
ATGGCGCTTCGTGTACTGCTTCATAGGTTTATTTTTCCTACTGTNNAXGGCACAGATTTCTATATTGATCTCAAGAAAGTTGAAGAAGAC
AACCAACANCATGTTGXTCTCAGCCAGGCACTTCGTGTTTTCACCAGAGGAGCCAATAGAAGGCTAGTTCAAGACATAGTTTTAAAGGTT
GCAAAATACTTGAACAATGGGGATATTGCTCTAGCTCCAGCACCAGCTCCACCTCCCAGTCCATTGGATTGTGGAGGATTTGCAAATACA
GATGCAGTTTACACTCGAGGCCCAATGTGTGTTTTAGGGCATGTGGAACATGTTGTGTTAGGTGCAAATGXTGTGCCACCAGGGACCTTT
GGGAACAGAGACAAGTGTGGCAAATGTTACACTGAAATGACTACCCATGGCAACAAGACCAAGTGCCCTTAA
Edits in Original Sequence 
GTCTCAGCCAGGCACTTCGTGTTTTCACCAGAGGAGCCAATAGAAGGCTAGTTCAAGACATAGTTTTAAAGGTTGCAAAATACTTGAACA
ATGGG
(5')ATGGCGCTTCGTGTACTGCTTCtATAGGTTTATTTTTCCTACTGTNNAXGGCACAGATTTCTATATTGATCTCAAGAAAGT
TGAAGAAGACAACCAACANCATGTTGXTCTCAGCCAGGCACTTCGTGTTTTCACCAGAGGAGCCAATAGAAGGCTAGTTCAAGACATAGT
TTTAAAGGTTGCAAAATACTTGAACAATGGGGATATTGCTCTAGCTCCAGCACCAGCTCCACCTCCCAGTCCATTGGATTGTGGAGGATT
gTGCAAATACAGATGCAGTTTACACTCGAGGCCCAATGTGTGTTTTAGGGCATGTGGAACATGTTGTGTTAGGTGCAAATGXTGTGCCAC
CAGGGACCTTTGGGAACAGAGACAAGTGTGGCAAATGTTACACTGAAATGACTACCCATGGCAACAAGACCAAGTGCCCTTAA(3')ATC
ACTTGGTTGCTATTTGTTTAAAGTGGCGGAGTTAAAAACTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan