Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U346813

Score 
450
Direction 
Reverse
Predicted Peptide Sequence 
PKKEYKGFFFLKNWFLQGSPPFGKPLHKKFSFVPKGPLSPXKKNTRAFFVKKCFFKRSPFREDTYKKPSFPEDIYKKAPMVPKDPLVLKP
EYRVLFPKDQYSQKFTGFRRXLQERYXYVSEVPSVTNPESKVLSFPKNDYYKKPSVSEDNYKKVSNVIPEVPSVAKLEYKVPALSKNDYY
TKPFPSPSPPPPYY
Predicted Coding Sequence 
XGTCCTAAGAAAGAATACAAGGGTTTTTTTTTTCTCAAAAATTGGTTCTTACAAGGAAGCCCTCCGTTTGGGAAGCCACTTCACAAAAAA
TTTTCATTTGTTCCCAAAGGTCCCCTAAGCCCTAAXAAAAAGAATACAAGGGCCTTTTTTGTCAAGAAATGTTTTTTCAAGAGGTCACCT
TTCCGAGAAGATACCTACAAGAAGCCTTCTTTTCCGGAAGATATTTACAAGAAGGCTCCAATGGTCCCAAAGGACCCTTTGGTTCTAAAA
CCAGAATACAGGGTCCTTTTTCCCAAAGACCAATATTCACAGAAGTTCACCGGTTTCAGAAGATAGCTACAAGAGAGGTATXCATATGTT
TCGGAGGTACCTTCAGTTACTAACCCGGAATCCAAGGTGCTTTCTTTCCCAAAGAATGATTACTACAAGAAGCCATCAGTTTCTGAAGAT
AACTACAAGAAAGTGTCAAATGTTATTCCAGAGGTACCCTCAGTTGCTAAACTTGAATACAAGGTGCCTGCTTTGTCAAAAAATGACTAC
TACACGAAGCCATTCCCTTCTCCGTCACCACCACCTCCATATTATTAA
Edits in Original Sequence 
(5')XGTCCTAAGAAAGAATACAAGGGTTTTTTTTTTCTCAAAAATTGGTTCTTACAAGGAAGCCCTCCGTTTGGGAAGCCACTTCACAA
AAAATTTTCATTTGTTCCCAAAGGTCCCCTAAGCCCTAAXAAAAAGAATACAAGGGCCTTTTTTGTCAAGAAATGTTTTTTCAAGAGGTC
ACCTTTCCGAGAAGATACCTACAAGAAGCCTTCTTTTCCGGAAGATATTTACAAGAAGGCTCCAATGGTCCCAAAGGACCCTTTGGTTCT
AAAACCAGAATACAGGGTCCTTTTTCCCAAAGACCAATATTCACAGAAGTTCACCGGTTTCAGAAGATAGCTACAAGAGAGGTATXCATA
TGTTTCGGAGGTACCTTCAGTTACTAACCCGGAATCCAAGGTGCTTTCTTTCCCAAAGAATGATTACTACAAGAAGCCATCAGTTTCTGA
AGATAACTACAAGAAAGTGTCAAATGTTATTCCAGAGGTACCCTCAGTTGCTAAACTTGAATACAAGGTGCCTGCTTTGTCAAAAAATGA
CTACTACACGAAGCCATTCCCTTCTCCGTCACCACCACCTCCATATTATTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan