Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U346878

Score 
53
Direction 
Forward
Predicted Peptide Sequence 
KRTWXXXARXLYDVAWTXXPCGCCRSTTSGSPGLQEFGTRADIRIELKDSSCACGDVKQSVELEMMNLHEGTRVEDLVKRDVSPIDHKIT
GILRSECDVIAMEERLESAGFEYNEEVDEKVTKRCLKDPRLALRFFDWLKTREGFRHTTGTYTTMINMAADCKEFRLLDQXGGRKGEEAL
LAKPYYVEHSVIALWEWTVDXKDRXSMLEQIKKMRYEPAIRADTIVLSLLRHAGTANISLQYFYRKILKSFDXVIGLGRPLTHKQVFTTG
NLTPAYKNWWPTMNRGFFYFPKNPLLPALX
Predicted Coding Sequence 
XTGAAACGAACCTGGNNGNNGNNNGCCCGCCNTCTTTATGACGTAGCATGGACTGNAAGNCCCTGCGGTTGTTGCCGATCTACAACTAGT
GGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGCTGATATTAGGATAGAGCTGAAGGATTCATCATGTGCTTGTGGAGATGTGAAGCAG
AGTGTAGAGCTGGAAATGATGAATTTACACGAAGGTACTCGGGTTGAGGATTTGGTGAAAAGGGATGTTAGTCCTATTGATCACAAGATT
ACGGGGATTTTGAGGAGTGAATGTGATGTGATCGCGATGGAGGAACGGCTGGAAAGTGCAGGTTTTGAGTATAACGAGGAGGTCGATGAG
AAGGTTACGAAGAGGTGTCTTAAAGATCCACGATTAGCTCTGAGGTTTTTCGATTGGTTGAAAACAAGAGAAGGGTTTAGACATACTACC
GGGACTTATACCACCATGATTAACATGGCTGCGGACTGTAAGGAGTTCCGCTTGCTTGATCAAXTTGGTGGAAGAAAAGGAGAGGAGGCC
TTGTTGGCAAAACCTTATTACGTGGAGCATTCAGTTATCGCATTATGGGAATGGACTGTTGATXTGAAAGACCGTAGXTCAATGTTGGAA
CAGATTAAGAAAATGCGTTATGAGCCCGCCATAAGGGCAGATACCATCGTGTTGAGTTTACTTCGACATGCTGGAACAGCAAATATAAGT
TTGCAGTACTTTTACAGAAAGATCCTTAAGAGCTTTGACAXTGTTATAGGCTTAGGCAGGCCATTAACTCACAAGCAGGTTTTCACAACG
GGGAATTTAACCCCAGCTTATAAAAATTGGTGGCCAACCATGAATAGGGGTTTCTTTTACTTTCCGAAAAACCCCCTTTTACCCGCTTTA
TGX
Edits in Original Sequence 
(5')XTGAAACGAACCTGGNNGNNGNNNGCCCGCCNTCTTTATGACGTAGCATGGACTGNAAGNCCCTGCGGTTGTTGCCGATCTACAAC
TAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGCTGATATTAGGATAGAGCTGAAGGATTCATCATGTGCTTGTGGAGATGTGAA
GCAGAGTGTAGAGCTGGAAATGATGAATTTACACGAAGGTACTCGGGTTGAGGATTTGGTGAAAAGGGATGTTAGTCCTATTGATCACAA
GATTACGGGGATTTTGAGGAGTGAATGTGATGTGATCGCGATGGAGGAACGGCTGGAAAGTGCAGGTTTTGAGTATAACGAGGAGGTCGA
TGAGAAGGTTACGAAGAGGTGTCTTAAAGATCCACGATTAGCTCTGAGGTTTTTCGATTGGTTGAAAACAAGAGAAGGGTTTAGACATAC
TACCGGGACTTATACCACCATGATTAACATGGCTGCGGACTGTAAGGAGTTCCGCTTGCTTGATCAAXTTGGTGGAAGAAAAGGAGAGGA
GGCCTTGTTGGCAAAACCTTATTACGTGGAGCATTCAGTTATCGCATTATGGGAATGGACTGTTGATXTGAAAGACCGTAGXTCAATGTT
GGAACAGATTAAGAAAATGCGTTATGAGCCCGCCATAAGGGCAGATACCATCGTGTTGAGTTTACTTCGACATGCTGGAACAGCAAATAT
AAGTTTGCAGTACTTTTACAGAAAGATCCTTAAGAGCTTTGACAXTGTTATAGGCTTAGGCAGGCCATTAACTCACAAGCAGGTTTTCAC
AACGGGGAATTTAACCCCAGCTTATAAAAATTGGTGGCCAACCATGAATAGGGGTTTCTTTTACTTTCCGAAAAACCCCCTTTTACCCGC
TTTATGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan