ESTScan Details for Unigene SGN-U346921

Score 
594
Direction 
Reverse
Predicted Peptide Sequence 
MVDYLHQQXTVTGQNLTDLFDLLLIEVEEGVLFKQDDVVIVVESFTDLDFLTEXPVLLMVFLDVFRIEYEFRKFAIFPPGEIGCFTIFKA
LDFVLMNLPPPSHFGVLVSVENVTTLSGLRTCVVVFGNVLMDLDSVSEDENMLDSADEDESELKVLNFDYICNFPSISQSILHVKAYNFF
FLVVALSXLGLVAGAEFLQPGGSTSSRAAATAVELQLLFQMGXXXPLIP
Predicted Coding Sequence 
ATGGTTGACTATCTTCATCAACAAXTTACAGTAACAGGGCAAAATCTCACTGATCTTTTCGATTTATTACTTATCGAAGTCGAGGAAGGG
GTTTTGTTTAAGCAAGATGATGTTGTCATAGTAGTTGAATCATTCACTGATCTTGATTTCCTGACTGAAXCTCCAGTCCTCTTGATGGTT
TTTCTTGATGTTTTTCGAATTGAATATGAATTTAGAAAGTTTGCTATTTTCCCACCTGGTGAAATAGGTTGTTTCACCATCTTCAAGGCT
CTTGATTTTGTCCTCATGAACCTTCCTCCTCCTTCACATTTTGGAGTTTTAGTCTCTGTAGAGAATGTAACAACCCTGTCTGGTCTTCGG
ACTTGTGTTGTTGTTTTTGGCAATGTATTGATGGATCTTGACTCTGTTTCTGAAGATGAAAACATGCTTGACTCTGCTGATGAAGATGAA
TCTGAACTGAAGGTCCTGAACTTTGACTATATTTGTAACTTTCCATCCATTTCTCAATCAATATTGCACGTGAAGGCTTACAATTTCTTC
TTCCTTGTTGTTGCTCTTTCTXATTTGGGACTTGTTGCTGGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCC
ACCGCGGTGGAGCTCCAGCTTTTGTTTCAAATGGGNNNAANNNCCCCTTTAATCCCX
Edits in Original Sequence 
ACAGGGCAAAATCTCACTGATCTTTTCGATTTATTACTTATCGAAGTCGAGGAAGGGGTTTTGTTTAAGCAAGATGATGTTGTCATAGTA
GTTGAATCATTCACTGATCTTGATTTCCTGACTGAACTCCAGTCCTCTTGATGGTTTTTCTTGATGTTTTTCGAATTGAATATCGAATTT
AGAAAGTTTGCTATTTTCCCACCTGGTGAAATAGGTTGTTTCACCATCTTCAAGGCTCTTGATTTTGTCCTCATGA
(5')ATGGTTGACT
ATCTTCATCAACAAXTTACAGTAACAGGGCAAAATCTCACTGATCTTTTCGATTTATTACTTATCGAAGTCGAGGAAGGGGTTTTGTTTA
AGCAAGATGATGTTGTCATAGTAGTTGAATCATTCACTGATCTTGATTTCCTGACTGAAXCTCCAGTCCTCTTGATGGTTTTTCTTGATG
TTTTTCGAATTGAATATcGAATTTAGAAAGTTTGCTATTTTCCCACCTGGTGAAATAGGTTGTTTCACCATCTTCAAGGCTCTTGATTTT
GTCCTCATGAACCTTCCTCCTCCTTCACATTTTGGAGTTTTAGTCTCTGTAGAGAATGTAACAACCCTGTCTGGTCTTCGGACTTGTGTT
GTTGTTTTTGGCAATGTATTGATGGATCTTGACTCTGTTTCTGAAGATGAAAACATGCTTGACTCTGCTGATGAAGATGAATCTGAACTG
AAGtGTCCTGAACTTTGACTATATTTGTAACTTTCCATCCATTTCTCAATCAATATTGCACGTcGAAGGCTTACAATTTCTTCTTCCTTG
TTGTTGCTCTTTCTXATTTGGGACTTGTTGCTGGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGG
TGGAGCTCCAGCTTTTGTTTCAAATGGGNNNAANNNCCCCTTTAATCCCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan