ESTScan Details for Unigene SGN-U346975

Score 
213
Direction 
Reverse
Predicted Peptide Sequence 
LKLVSIHLGPNLIYKTLEKVHIIRNRLKIAIAGKNLIHHRRRELEFEEDDQLYLKFAYESGGEIGKKETLIPRYVGPYEILQKIGKVAYE
LRLPSELASVHPVFHNSMLKKCIGDPESILPIEGLGVQENLSYEEVPVQILNKQVKGVKEQIGGVRKGVMEESQVEGETWEAETDMKSRH
PHLFDN
Predicted Coding Sequence 
XXGTTGAAGTTGGTTAGTATTCACTTGGGTCCCAATTTGATTTATAAGACTTTAGAGAAGGTTCATATTATAAGGAATCGCTTGAAAATA
GCCATTGCCGGCAAAAATCTTATCCACCATAGGAGAAGGGAATTAGAGTTTGAAGAAGATGATCAATTGTATCTAAAATTTGCCTATGAA
AGTGGTGGTGAAATTGGAAAGAAAGAGACGTTGATTCCTCGTTATGTGGGTCCCTATGAAATCTTGCAAAAGATTGGTAAGGTGGCCTAT
GAGTTGAGGTTGCCTAGTGAATTGGCTTCGGTTCATCCGGTGTTCCATAATTCCATGCTTAAGAAGTGTATCGGTGATCCCGAGTCCATT
CTTCCTATTGAAGGTCTAGGTGTTCAAGAGAACCTCTCTTATGAGGAGGTTCCGGTTCAAATCCTTAATAAACAAGTXAAAGGAGTTAAG
GAACAAATAGGTGGCGTTCGTAAAGGTGTTATGGAAGAATCACAAGTTGAGGGTGAAACATGGGAGGCCGAGACCGACATGAAGTCACGT
CACCCTCATCTATTTGATAACTAA
Edits in Original Sequence 
(5')XXGTTGAAGTTGGTTAGTATTCACTTGGGTCCCAATTTGATTTATAAGACTTTAGAGAAGGTTCATATTATAAGGAATCGCTTGAA
AATAGCCtATTGCCGGCAAAAATCTTATCCaACCATAGGAGAAGGGAATTAGAGTTTGAAGAAGATGATCAATTGTATCTAAAATTTcGC
CTATGAAAGTGGTGGTGAAAtTTGGAAAGAAAGAGACGTTGATTCCTCGTTATGTGGGTCCCTATGAAATCTTGCAAAAGATTGGTAAGG
TGGCCTATGAGTTGAGGTTGCCTAGTGAATTGGCTTCGGTTCATCCGGTGTTCCATAATTCCATGCTTAAGAAGTGTATCGGTGATCCCG
AGTCCATTCTTCCTATTGAAGGTCTAGGTGTTCAAGAGAACCTCTCTTATGAGGAGGTTCCGGTTCAAATCCTTAATAAACAAGTXAAAG
GAGTTAAGGAACAAATAGGTGGCGTTCGTAAAGGTGTTATGGAAGAATCACAtAGTTGAGGGTGAAACATGGGAGGCCGAGACCGACATG
AAGTCACGTCACCCTCATCTATTTGATAACTAA(3')TGAAGTTGCTTTGATTTTTAATGAAGTGTTGCAAAAATGTCCATGTTACAGTA
ACATTACAGTGAAATGTACCTATTTAACTTGAAAATTGTCAATTTTGCTCTTTTGCTTGTTATGAATTTATGTGGTGGAATTTTTGTATA
TTGTGCCTTCGTGAATTGTATTGAGCACGTTAATATGTGTTGAAAAAAGCTTTGGCATAATGAATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan