ESTScan Details for Unigene SGN-U347034

Score 
519
Direction 
Forward
Predicted Peptide Sequence 
DPRGGAQNSGSPGLQEFGTRQFSNSSHVVGTVSRIIQQLNWSPETENALRELNYLLDPYQANQVLKQIHDHAVALGFFYWLKQQPGFKHD
GHTYTTMVGILGRARQFGAINKLLEQMVKDGCQPNVVTYNRLIHSYGRANYLREALHVFSQMQEARVEPDRVTYCTLIDIHAKAGYLDVA
MDLYERMQDAGLSPDTFTYSVIINCLGKAGHLDAAAQTVLEMVNQGCVPNLVTYNIMIALHAKARNYSSALQLYRDMQNAGFEPDKVTYS
IVMEVLGHCGYLEEAEAVFTEMKRKNWVPDEPXDMGLYGTYGGKGGNVKKAWELDLGMINAXFYAPMGPTCKFSAQGFPLKITGGLRRNN
LLQRMVGIRAXNPSLEKYNLASSSGGTKNSKTPLKMYLCLGSEGGTTLHKKPILFGPVPQXEPQWVKGGEPGGNLCVLCQRENKKEKRVF
X
Predicted Coding Sequence 
XCGGATCCGCGGGGCGGCGCTCAGAATAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCAGTTCTCTAATAGTAGTCATGTTGTT
GGAACAGTTTCTCGCATTATACAACAGTTAAATTGGAGTCCCGAGACAGAAAATGCTCTTCGTGAACTCAACTATTTATTAGATCCATAC
CAAGCAAACCAAGTTCTTAAGCAGATCCATGATCATGCGGTTGCTCTTGGCTTTTTCTACTGGTTGAAGCAGCAACCAGGATTTAAGCAT
GACGGACACACCTATACGACCATGGTTGGCATCCTGGGACGTGCTAGGCAGTTTGGGGCTATTAACAAGTTGCTTGAGCAGATGGTCAAA
GATGGATGCCAACCAAATGTAGTGACATATAACCGTCTCATTCATAGTTATGGCAGAGCAAACTACTTGCGTGAAGCATTACATGTCTTT
AGTCAAATGCAGGAAGCTAGAGTTGAACCTGACCGTGTAACCTATTGTACTCTTATTGACATCCATGCAAAAGCTGGTTACCTTGATGTT
GCTATGGACTTGTATGAAAGGATGCAAGATGCTGGGCTCTCTCCCGACACTTTTACTTACAGTGTCATTATTAATTGCCTTGGAAAAGCA
GGCCATTTAGATGCTGCXGCACAAACTGTTCTTGAGATGGTTAATCAGGGTTGTGTGCCAAACTTGGTAACCTACAACATTATGATTGCA
TTGCATGCAAAAGCAAGGAACTATTCTAGTGCATTACAATTATATCGAGACATGCAGAATGCTGGATTTGAGCCAGACAAGGTGACATAC
AGCATTGTGATGGAGGTGCTTGGCCATTGTGGCTATCTGGAGGAAGCTGAGGCAGTTTTTACTGAGATGAAAAGGAAGAATTGGGTACCT
GATGAACCCXTGGATATGGGCCTCTATGGGACTTATGGGGGAAAGGGTGGGAATGTAAAAAAAGCCTGGGAACTGGATCTTGGCATGATT
AATGCAGXGTTTTATGCCCCAATGGGGCCAACATGCAAATTCTCTGCTCAAGGGTTTCCCTTAAAGATTACCGGTGGCCTGAGGCGTAAC
AATTTGCTTCAAAGGATGGTTGGAATTAGGGCTXTAAACCCTTCCTTGGAAAAATATAACCTTGCTTCCTCAAGCGGCGGGACCAAAAAC
TCAAAAACTCCTTTGAAAATGTATCTTTGTTTGGGGAGCGAGGGAGGTACCACACTCCACAAGAAACCCATTCTCTTTGGACCTGTGCCC
CAANGGGAACCCCAGTGGGTAAAGGGAGGGGAACCCGGGGGCAACCTTTGTGTGCTCTGCCAGAGGGAGAACAAGAAAGAAAAGAGGGTT
TTTGXX
Edits in Original Sequence 
(5')XCGGATCCGCGGGGCGGCGCTCAGAATAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCAGTTCTCTAATAGTAGTCATGT
TGTTGGAACAGTTTCTCGCATTATACAACAGTTAAATTGGAGTCCCGAGACAGAAAATGCTCTTCGTGAACTCAACTATTTATTAGATCC
ATACCAAGCAAACCAAGTTCTTAAGCAGATCCATGATCATGCGGTTGCTCTTGGCTTTTTCTACTGGTTGAAGCAGCAACCAGGATTTAA
GCATGACGGACACACCTATACGACCATGGTTGGCATCCTGGGACGTGCTAGGCAGTTTGGGGCTATTAACAAGTTGCTTGAGCAGATGGT
CAAAGATGGATGCCAACCAAATGTAGTGACATATAACCGTCTCATTCATAGTTATGGCAGAGCAAACTACTTGCGTGAAGCATTACATGT
CTTTAGTCAAATGCAGGAAGCTAGAGTTGAACCTGACCGTGTAACCTATTGTACTCTTATTGACATCCATGCAAAAGCTGGTTACCTTGA
TGTTGCTATGGACTTGTATGAAAGGATGCAAGATGCTGGGCTCTCTCCCGACACTTTTACTTACAGTGTCATTATTAATTGCCTTGGAAA
AGCAGGCCATTTAGATGCTGCXGCACAAACTGTTCTgTGAGATGGTTAATCAGGGTTGTGTGCCAAACTTGGTAACCTACAACATTATGA
TTGCATTGCATGCAAAAGCAAGGAACTATTCTAGTGCATTACAATTATATCGAGACATGCAGAATGCTGGATTTGAGCCAGACAAGGTGA
CATACAGCATTGTGATGGAGGTGCTTGGCCATTGTGGCTATCTGGAGGAAGCTGAGGCAGTTTTTACTGAGATGAAAAGGAAGAATTGGG
TACCTGATGAACCCXTGGATATGGGCCTCTATGGGACTTATGGGGGAAAGGGTGGGAATGTAAAAAAAGCCTGGGAACTGGtATCTTGGC
ATGATTAATGCAGXGTTTTATGCCCCAATGGGGCCAACATGCAAATTCTCTGCTCAAGGGTTTCCCTTAAAGATTACCgGGTGGCCTGAG
GCGTAACAATTTGCTTCAAAGGATGGTTGGAATTAGGGCTXTAAACCCTTCCTTGGAAAAATATAACCTTGCTTCCTCAAGCGGCGGGAC
CAAAAACTCAAAAACTCCTTTGAAAATGTATCTTTGTTTGGGGAGCGAGGGAGGTACCACACTCCACAAGAAACCCATTCTCTTTGGACC
TGTGCCCCAANGGGAACCCCAGTGGGTAAAGGGAGGGGAACCCGGGGGCAACCTTTGTGTGCTCTGCgCAGAGGGAGAACAAGAAAGAAA
AGAGGGTTTTTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan