ESTScan Details for Unigene SGN-U347039

Score 
102
Direction 
Forward
Predicted Peptide Sequence 
KGLRPLREKYSSWGEEWLSARKDENEFGPFSAWNITGTFKGGW
Predicted Coding Sequence 
AAGGGACTCAGACCTCTTAGAGAAAAGTATAGTTCGTGGGGCGAAGAGTGGCTTTCTGCAAGGAAAGATGAGAATGAATTTGGGCCATTT
TCTGCTTGGAATATAACAGGGACCTTCAAAGGAGGTTGG
Edits in Original Sequence 
GCTATTTTCTTGTCCAAAATTGACCAGTGAACGCCCTTTTTGTTGGAACCAAAAAAAAATAAAAAAAATTCATCTATTTAGGTTGTAGAT
TAGCCGTTGAGCTCTCATTTTCTCAAAAATTTGCTGGTGTTTTGGTGCTTGTTGTTGGGTTGCTAGTTCTAAGATTTTTTGTTTTTGTTT
TTATTTTGACTTCACTTGAAGCAACCCCATTTGGTTGTATATCTTAAATATTTCTTCTTTTAAACTGTAATGGACTTAAATTTTTCATCT
GGG
(5')AAGGGACTCAGACCTCTTAGAGAAAAGTATAGTTCGTGGGGCGAAGAGTGGCTTTCTGCAAGGAAAGATGAGAATGAATTTGG
GCCATTTTCTGCTTGGAATATAACAGGGACCTTCAAAGGAGGTTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan