ESTScan Details for Unigene SGN-U347095

Score 
-333
Direction 
Reverse
Predicted Peptide Sequence 
NAYNCPFAIQAAQLLGRAIGAGPLAITPAGERGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRAIGYRGP
Predicted Coding Sequence 
AACGCTTACAATTGCCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGGCCTCTTGCTATTACGCCAGCTGGC
GAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGT
AATACGACTCACTATAGGGCAATTGGGTACCGGGGCCCC
Edits in Original Sequence 
ATGATGGAGAGAGTTCAAACGAGAACTTCTGTAGGATCATTGCTATTGTCATCTTTGCTTCCGTCATTACAAAGTTTTGTCCGATGCAAA
TTCGGGGTCCCCAACCAAATGGAATAAACGAGACTTGTCCGTTTGTTGCCTTTGACACTCCTTCACTGAATCGATCTGGTTTGAATTCCT
TCGCGTCT
(5')AACGCTTACAATTGCCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGGCCTCTTcGCTAT
TACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACG
GCCAGTGAATTGTAATACGACTCACTATAGGGCgAATTGGGTACCGGGGCCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan