ESTScan Details for Unigene SGN-U348025

Score 
588
Direction 
Forward
Predicted Peptide Sequence 
MEVPGEDEVKKAEDRMTSAAAFVEGGIQEACDDSCSICLEAFCESDPSTVTICKHEFHLQCILEWCQRSSNCPMCWQTISLKDPASQQLL
DAVEREKRIRFTPARNATIFHHPTLGDFELQHLPVGVNDSELEERIIQHLAAAAAMGRARHIARREGSRGHSSAQGRPHFLVFSTHASAP
GPGAGPASASVGAEPEADATAPVNDPSVTHRAISSESLQCTPNLTSVPSGQLSASSSGSVAMLNNPRDLSTDNRSVARQAPSGQDRAGTS
DFQSFSDSWRSRFSAMSMKYKESLSKSTRGWKERLFARSNSMADIRSEVRREVNAGIASVSRMMERLETRENSRPGPVSTSNNPPVTEQN
NPGNLDESPLSDISALPANSVSRX
Predicted Coding Sequence 
ATGGAGGTTCCGGGGGAGGATGAGGTTAAAAAGGCAGAGGATCGTATGACATCAGCCGCGGCTTTTGTTGAAGGAGGTATACAGGAGGCA
TGTGATGATTCATGCAGCATATGCCTTGAAGCCTTCTGCGAAAGTGATCCATCCACGGTAACTATTTGCAAGCATGAGTTTCACCTTCAA
TGTATTCTTGAATGGTGTCAAAGAAGTTCGAATTGTCCAATGTGCTGGCAAACTATAAGTTTGAAAGATCCTGCTAGTCAACAATTGCTT
GATGCTGTAGAAAGAGAGAAACGTATTAGGTTCACTCCAGCAAGAAATGCCACGATATTTCATCATCCCACTCTGGGGGATTTTGAACTG
CAACACTTGCCTGTTGGAGTTAATGATTCTGAACTGGAAGAACGCATTATTCAGCACTTGGCTGCTGCTGCTGCAATGGGAAGGGCACGT
CATATTGCTCGTAGAGAGGGCTCAAGGGGTCACTCATCTGCTCAGGGTCGTCCACATTTTCTGGTGTTTTCCACACATGCCAGTGCCCCA
GGTCCAGGCGCTGGTCCTGCTTCAGCTTCTGTAGGAGCGGAACCTGAGGCAGATGCAACAGCCCCTGTTAATGATCCTTCTGTCACTCAC
CGAGCAATCAGCAGTGAATCATTGCAATGCACCCCAAATCTTACTAGTGTTCCTAGTGGTCAACTCTCTGCTTCGTCATCTGGATCAGTT
GCCATGCTTAACAACCCTCGAGATCTCTCCACTGACAATAGAAGCGTGGCTCGTCAGGCACCATCAGGTCAAGATAGAGCAGGAACATCA
GATTTCCAGTCTTTTTCAGATTCCTGGAGATCTCGTTTTAGTGCAATGTCAATGAAATACAAAGAATCTCTTTCAAAGAGCACAAGAGGA
TGGAAAGAAAGGCTTTTTGCACGAAGTAATTCCATGGCAGATATTCGCTCAGAAGTTAGGAGAGAAGTGAATGCTGGAATTGCTAGTGTT
TCCCGCATGATGGAACGCCTAGAAACAAGAGAAAACAGTAGACCTGGTCCTGTTTCAACGTCAAATAATCCTCCAGTGACTGAGCAAAAT
AACCCTGGGAATTTGGATGAATCACCGTTGAGTGACATTTCGGCTCTTCCTGCAAATTCTGTCTCGCGTTAA
Edits in Original Sequence 
GTTGGACCTTTTCGGCTTTTCCTCTTTCTCTAATCTCTATCCATCTCTTTCTTTGTTTCTTTGTCTCTGGGTCCAAGAATAATTTGGGCT
TAGCTGAATGGGAACTTAGAGTTATCTTCATCCAGGAAAATAGGGGATAAAAATCAGAGCTTTGGCTTAAAAATTTCCATGGAAATTTCT
TGACCCATTTTTCTAGGCCATATCTTCTTTCA
(5')ATGGAGGTTCCGGGGGAGGATGAGGTTAAAAAGGCAGAGGATCGTATGACATCA
GCCGCGGCTTTTGTTGAAGGAGGTATACAGGAGGCATGTGATGATTCATGCAGCATATGCCTTGAAGCCTTCTGCGAAAGTGATCCATCC
ACGGTAACTATTTGCAAGCATGAGTTTCACCTTCAATGTATTCTTGAATGGTGTCAAAGAAGTTCGAATTGTCCAATGTGCTGGCAAACT
ATAAGTTTGAAAGATCCTGCTAGTCAACAATTGCTTGATGCTGTAGAAAGAGAGAAACGTATTAGGTTCACTCCAGCAAGAAATGCCACG
ATATTTCATCATCCCACTCTGGGGGATTTTGAACTGCAACACTTGCCTGTTGGAGTTAATGATTCTGAACTGGAAGAACGCATTATTCAG
CACTTGGCTGCTGCTGCTGCAATGGGAAGGGCACGTCATATTGCTCGTAGAGAGGGCTCAAGGGGTCACTCATCTGCTCAGGGTCGTCCA
CATTTTCTGGTGTTTTCCACACATGCCAGTGCCCCAGGTCCAGGCGCTGGTCCTGCTTCAGCTTCTGTAGGAGCGGAACCTGAGGCAGAT
GCAACAGCCCCTGTTAATGATCCTTCTGTCACTCACCGAGCAATCAGCAGTGAATCATTGCAATGCACCCCAAATCTTACTAGTGTTCCT
AGTGGTCAACTCTCTGCTTCGTCATCTGGATCAGTTGCCATGCTTAACAACCCTCGAGATCTCTCCACTGACAATAGAAGCGTGGCTCGT
CAGGCACCATCAGGTCAAGATAGAGCAGGAACATCAGATTTCCAGTCTTTTTCAGATTCCTGGAGATCTCGTTTTAGTGCAATGTCAATG
AAATACAAAGAATCTCTTTCAAAGAGCACAAGAGGATGGAAAGAAAGGCTTTTTGCACGAAGTAATTCCATGGCAGATATTCGCTCAGAA
GTTAGGAGAGAAGTGAATGCTGGAATTGCTAGTGTTTCCCGCATGATGGAACGCCTAGAAACAAGAGAAAACAGTAGACCTGGTCCTGTT
TCAACGTCAAATAATCCTCCAGTGACTGAGCAAAATAACCCTGGGAATTTGGATGAATCACCGTTGAGTGACATTTCGGCTCTTCCTGCA
AATTCTGTCTCGCGTTAA(3')GTGGTATACATTGTTTAAGCTGTTGCATCTTTCCTCAGCATTGCAGCTTTGGAGGTTATTAAAACTCG
TCCTCCAAATGTGAAATGCTGATAGAGGATGCTTATATGGGCAGGGCAGAATGTTGGAGAGAACCATTACTGATAGATGATGCCAATTAG
GGAAAGAGAGAGCCTGAGGCGGAGCAGCGATTTCTGCGTTAAAACGCTGTAAATTTGTTTATGCAAACTTGGGTTTGTTATGTATTGCAC
TCCAATGCTTGTAATAGCTGTTGGACTGAAGTGGCAGTCTTCTATACCCTTCTGCTTGAGAACTAATTTTTCTCTAATTCTAAGGCTGAA
GGCTAATGAGCCCCAGCAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan