ESTScan Details for Unigene SGN-U349049

Score 
277
Direction 
Forward
Predicted Peptide Sequence 
XMASNVLPSTVNPPPENYIHNPAAIFPLLQIPQVDLCVLNSEPSSPEATQELKILRFSLTVCGFFQHKYSRPAGDLDLAGFGNDQTLTQH
QTLDWNDVLYLDLYPEDQRTLKLWPDNPNDFRKVLLECRAKLQKLNELILKAMANSLNLEDNTFLKQYGESPRVLSRFNSHHPCSGSGPQ
VEAKPHSDASTLTFFLQDKPVEALQVLRGDKWFRLPAIAHPAILVMPGDQAEIMTNGLFKSLLHRFVANSERERISISIFFIPDKENVIE
PAEGLVDEKRPSLYRPVVDYVGAFCPEHREGNRVIDALKKXX
Predicted Coding Sequence 
XAAATGGCTTCCAACGTATTACCGTCCACAGTCAATCCCCCGCCGGAAAATTATATCCACAACCCAGCAGCCATCTTTCCACTGCTACAG
ATACCTCAGGTTGACCTTTGCGTCCTCAATAGTGAACCATCATCACCTGAAGCCACTCAGGAGCTCAAGATTCTCCGGTTTTCTTTGACC
GTGTGCGGTTTCTTTCAGCACAAATATTCACGACCAGCTGGTGATCTTGATCTTGCTGGTTTTGGAAATGATCAAACTCTCACTCAACAT
CAGACCCTTGACTGGAATGACGTGTTGTATCTCGACTTGTATCCTGAAGATCAAAGGACACTAAAATTATGGCCTGACAATCCTAACGAC
TTCAGGAAAGTTTTGCTCGAGTGTAGGGCGAAGTTACAAAAATTAAATGAGCTCATCCTCAAGGCCATGGCAAATTCGCTCAACTTGGAA
GACAATACCTTTCTGAAGCAATATGGAGAAAGCCCAAGGGTGCTATCAAGATTTAACTCTCATCATCCGTGTTCAGGATCAGGACCCCAA
GTTGAAGCCAAACCGCATTCGGATGCATCGACATTGACTTTTTTCTTACAAGACAAACCAGTGGAAGCCCTTCAAGTCCTAAGAGGTGAT
AAATGGTTCAGACTTCCTGCCATTGCTCATCCTGCTATACTTGTTATGCCTGGGGACCAAGCTGAGATAATGACTAATGGCCTATTCAAG
AGCCTGTTGCATAGGTTTGTGGCAAACTCAGAAAGAGAGAGGATCAGCATATCCATTTTCTTTATCCCTGATAAGGAAAATGTGATTGAA
CCAGCAGAAGGACTTGTTGATGAAAAAAGGCCAAGTTTATATAGACCAGTTGTAGATTATGTTGGTGCATTTTGCCCTGAGCATCGTGAA
GGGAACAGAGTGATTGATGCGCTGAAAAAATGAATX
Edits in Original Sequence 
(5')XAAATGGCTTCCAACGTATTACCGTCCACAGTCAATCCCCCGCCGGAAAATTATATCCACAACCCAGCAGCCATCTTTCCACTGCT
ACAGATACCTCAGGTTGACCTTTGCGTCCTCAATAGTGAACCATCATCACCTGAAGCCACTCAGGAGCTCAAGATTCTCCGGTTTTCTTT
GACCGTGTGCGGTTTCTTTCAGCACAAATATTCACGACCAGCTGGTGATCTTGATCTTGCTGGTTTTGGAAATGATCAAACTCTCACTCA
ACATCAGACCCTTGACTGGAATGACGTGTTGTATCTCGACTTGTATCCTGAAGATCAAAGGACACTAAAATTATGGCCTGACAATCCTAA
CGACTTCAGGAAAGTTTTGCTCGAGTGTAGGGCGAAGTTACAAAAATTAAATGAGCTCATCCTCAAGGCCATGGCAAATTCGCTCAACTT
GGAAGACAATACCTTTCTGAAGCAATATGGAGAAAGCCCAAGGGTGCTATCAAGATTTAACTCTCATCATCCGTGTTCAGGATCAGGACC
CCAAGTTGAAGCCAAACCGCATTCGGATGCATCGACATTGACTTTTTTCTTACAAGACAAACCAGTGGAAGCCCTTCAAGTCCTAAGAGG
TGATAAATGGTTCAGACTTCCTGCCATTGCTCATCCTGCTATACTTGTTATGCCTGGGGACCAAGCTGAGATAATGACTAATGGCCTATT
CAAGAGCCTGTTGCATAGGTTTGTGGCAAACTCAGAAAGAGAGAGGATCAGCATATCCATTTTCTTTATCCCTGATAAGGAAAATGTGAT
TGAACCAGCAGAAGGACTTGTTGATGAAAAAAGGCCAAGTTTATATAGACCAGTTGTAGATTATGTTGGTGCATTTTGCCCTGAGCATCG
TGAAGGGAACAGAGTGATTGATGCGCTGAAAAAATGAATX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan