ESTScan Details for Unigene SGN-U349389

Score 
255
Direction 
Forward
Predicted Peptide Sequence 
XLEELYKGSKRKMQISRIVLDDYGKPVTVEEVLSIHIKPGWKKGTKITFPEKGNYELGRAPGDLIFVVDEKPHAVFKRDGNDLVMNQRIS
LLDALTGKTLSLTTLDGRELSIPVKDIVKPGHELRIPNEGMPISKEPGKKGNLRIKFDIKFPSRLSSEQKSELRRVLGRTADXSKMKHX
Predicted Coding Sequence 
XGCTTGGAGGAGCTGTATAAAGGATCTAAAAGGAAGATGCAGATTTCCAGGATCGTCCTTGATGACTATGGCAAGCCTGTGACCGTGGAA
GAGGTGTTGTCAATACATATTAAACCAGGTTGGAAGAAGGGTACAAAGATTACATTCCCTGAGAAAGGGAACTACGAACTTGGTCGTGCT
CCTGGGGATCTGATATTTGTAGTTGATGAAAAACCTCATGCTGTTTTCAAGAGGGATGGCAATGATCTTGTCATGAATCAGAGGATTTCC
TTGCTGGACGCTCTCACTGGGAAGACTCTCAGCTTGACAACCTTGGATGGAAGAGAGCTGAGCATCCCAGTCAAAGATATTGTCAAACCT
GGCCATGAGCTGAGGATCCCAAATGAAGGGATGCCCATATCAAAAGAACCTGGTAAGAAAGGAAATTTGAGGATTAAGTTTGATATAAAA
TTCCCATCCAGGCTCAGCTCAGAACAAAAATCTGAACTGCGGAGGGTACTTGGGAGGACTGCTGATTAGTCCAAAATGAAGCACTGA
Edits in Original Sequence 
(5')XGCTTGGAGGAGCTGTATAAAGGATCTAAAAGGAAGATGCAGATTTCCAGGATCGTCCTTGATGACTATGGCAAGCCTGTGACCGT
GGAAGAGGTGTTGTCAATACATATTAAACCAGGTTGGAAGAAGGGTACAAAGATTACATTCCCTGAGAAAGGGAACTACGAACTTGGTCG
TGCTCCTGGGGATCTGATATTTGTAGTTGATGAAAAACCTCATGCTGTTTTCAAGAGGGATGGCAATGATCTTGTCATGAATCAGAGGAT
TTCCTTGCTGGACGCTCTCACTGGGAAGACTCTCAGCTTGACAACCTTGGATGGAAGAGAGCTGAGCATCCCAGTCAAAGATATTGTCAA
ACCTGGCCATGAGCTGAGGATCCCAAATGAAGGGATGCCCATATCAAAAGAACCTGGTAAGAAAGGAAATTTGAGGATTAAGTTTGATAT
AAAATTCCCATCCAGGCTCAGCTCAGAACAAAAATCTGAACTGCGGAGGGTACTTGGGAGGACTGCTGATTAGTCCAAAATGAAGCACTG
A(3')AGAATATAGCTAACCAGTTATAGTGGAAACGCACCTGGATGTAAATACATCGTGACTTTGCTTGGACTAGTAGGAAACACTGTGC
ATAATAGGAGTATAGTTTAATTCGGTCGCGTGCAATATATTTGAGTTGTGTCTGGCCCCAAGTGTAGCATATTGAGCTGGTGTTCTAGTG
ATCGATGTTAATTTTGGTGTTCAATGTTCAAATCTGTGGAATAGAAACCGAATAATGGTATTTTGGATTTGGTGGAGGTTGTCTGCCTCG
TAAAAAAAAAAAAAAAAAAAATTGATCCAGTTGTGTGAAAAGGGGGGGGCGTGTCACACTTCTGCCTTTTCGGGTTTGGAATCAGATACG
TTTGTGGTTGTTTATGCAACCAAAGGATTTTTTACGACAGAACAACACGGGAAAGTTGTTATGTCAAGTGTTTGGCACCCATGCTGCAAC
TTTGTGTCTCTTTGGCATTTCTGAACTTGAAGAAATCATGTGGAGTGCATTGAACTTTTCAGGGAGAAGAAATGTTTGGTGTCTCTACCC
TAATAAGAATGCTATGCCGATGTCTGTTCAGGACACATTCATTCAAAAATTCCTCCAGGGATCATCAGTCTGAACAGAATTCGGTACTTG
GAGATGAAAGACTGAATTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan