ESTScan Details for Unigene SGN-U349575

Score 
124
Direction 
Forward
Predicted Peptide Sequence 
XRAKETSQDATKYPQSQITGEYFLASPYPYKISCXLASSNPMEGMFDLEMALSMTTMEENYIQTKLFEAKTLNQNQLSEMPMVEAVGDCI
ICMEDFEPGVGGKKVPCGHVFHSSCIAQWLSDHNSCPLCRSTVLTATX
Predicted Coding Sequence 
XXCCGAGCTAAAGAAACATCGCAAGACGCTACAAAATACCCGCAATCCCAGATAACTGGTGAGTACTTCCTAGCTAGCCCATATCCTTAC
AAAATCTCGTGTGAXCTAGCATCATCAAATCCAATGGAGGGAATGTTTGATCTGGAGATGGCTCTGTCCATGACAACTATGGAGGAGAAC
TATATCCAGACAAAGTTGTTTGAAGCCAAGACTTTGAACCAGAATCAACTGAGTGAAATGCCGATGGTGGAAGCAGTTGGAGACTGCATA
ATTTGTATGGAAGATTTCGAGCCCGGCGTTGGGGGTAAAAAAGTTCCATGTGGGCACGTCTTCCATTCATCTTGTATAGCTCAGTGGCTC
TCCGATCACAATTCTTGTCCTCTTTGCCGATCCACAGTTCTCACTGCCACCTGA
Edits in Original Sequence 
(5')XXCCGAGCTAAAGAAACATCGCAAGACGCTACAAAATACCCGCAATCCCAGATAACTGGTGAGTACTTCCTAGCTAGCCCATATCC
TTACAAAATCTCGTGTGAXCTAGCATCATCAAATCCAATGGAGGGAATGTTTGATCTGGAGATGGCTCTGTCCATGACAACTATGGAGGA
GAACTATATCCAGACAAAGTTGTTTGAAGCCAAGACTTTGAACCAGAATCAACTGAGTGAAATGCCGATGGTGGAAGCAGTTGGAGACTG
CATAATTTGTATGGAAGATTTCGAGCCCGGCGTTGGGGGTAAAAAAGTTCCATGTGGGCACGTCTTCCATTCATCTTGTATAGCTCAGTG
GCTCTCCGATCACAATTCTTGTCCTCTTTGCCGATCCACAGTTCTCACTGCCACCTGA(3')ACATCTTTTCCTGTCACTTCATCGTTTG
AAAATACACATTCTTTTATTTTTTTTCCCCCTTCGATTTTGCATCAATTAATTATTTCTGTAACATGAATCAGGCTCCGTTGTCATAAAT
ATAGACTTGGCGCTGATTAATCGGACGTTACAATTTGTTATGAATATTCATGCTCCTTTATTAGATATGGATTGGAAGATGCAGACGACG
TCCTTTACTTCCTTCTGTTCCTCGAGTTTGTCATTTTTCCCCTTTGTTTCTCTTATCTTATTATTATCAGCAGATATGCAATGCACCGAG
ACATAGGATCCAAAGCTGCGTTAAAGCATTTGTGTTGTAATAGTTTAAAGACGTATTTGTTCTGCTTCTGGGGTTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan