ESTScan Details for Unigene SGN-U350705

Score 
233
Direction 
Reverse
Predicted Peptide Sequence 
AVPDTPGFLIIRTAGGAAAAAAAAIRFINFPLLRNLLQPFKTVPPSPSPGEYHRHLVADHGPHPASFHLHAHLSLPQEMRILPQLQLAPT
IQFPLIDIRYSPRILIIAIAVLPKSSLQQLDIITSVDLKAGALANPHSLPTTVLMMMMMMMMGGGRRRYKWVQRNKARGIGTKARPLDLQ
GSTIDSRKEMQGXRIIQEGRFLDLKQVGGDGERX
Predicted Coding Sequence 
GCGGTCCCCGACACTCCGGGCTTTCTCATCATCAGAACCGCAGGAGGAGCAGCAGCAGCAGCAGCCGCCGCCATCAGATTCATCAACTTC
CCTCTCCTCAGGAATCTCCTCCAACCATTCAAAACAGTGCCGCCTTCCCCTTCTCCGGGGGAGTACCATCGCCACCTTGTCGCTGATCAT
GGACCCCACCCCGCGTCCTTCCACCTCCACGCACACCTCAGCCTCCCGCAGGAAATGAGAATCCTCCCCCAACTCCAACTGGCACCTACA
ATCCAATTTCCACTTATTGACATCCGCTACTCCCCGCGGATCCTCATTATCGCGATCGCCGTCCTTCCTAAAAGTTCCCTTCAACAACTT
GACATCATCACTAGCGTAGATCTCAAAGCGGGAGCCTTGGCTAACCCTCACTCTCTCCCTACTACCGTACTGATGATGATGATGATGATG
ATGATGGGCGGCGGCCGAAGAAGATACAAGTGGGTGCAGCGTAATAAAGCCAGGGGTATCGGGACGAAGGCTCGACCCCTCGATCTCCAA
GGAAGCACCATTGATTCGAGGAAGGAAATGCAGGGTTAGAGAATCATACAAGAAGGCCGGTTTCTTGATCTGAAGCAAGTTGGTGGTGAT
GGAGAACGATAA
Edits in Original Sequence 
(5')GCGGTCCCCGACACTCCGGGCTTTCTCATCATCAGAACCGCAGGAGGAGCAGCAGCAGCAGCAGCCGCCGCCATCAGATTCATCAA
CTTCCCTCTCCTCAGGAATCTCCTCCAACCATTCAAAACAGTGCCGCCTTCCCCTTCTCCGGGGGAGTACCATCGCCACCTTGTCGCTGA
TCATGGACCCCACCCCGCGTCCTTCCACCTCCACGCACACCTCAGCCTCCCGCAGGAAATGAGAATCCTCCCCCAACTCCAACTGGCACC
TACAATCCAATTTCCACTTATTGACATCCGCTACTCCCCGCGGATCCTCATTATCGCGATCGCCGTCCTTCCTAAAAGTTCCCTTCAACA
ACTTGACATCATCACTAGCGTAGATCTCAAAGCGGGAGCCTTGGCTAACCCTCACTCTCTCCCTACTACCGTACTGATGATGATGATGAT
GATGATGATGGGCGGCGGCCGAAGAAGATACAAGTGGGTGCAGCGTAATAAAGCCAGGGGTATCGGGACGAAGGCTCGACCCCTCGATCT
CCAAGGAAGCACCATTGATTCGAGGAAGGAAATGCAGGGTTAGAGAATCATACAAGAAGGCCGGTTTCTTGATCTGAAGCAAGTTGGTGG
TGATGGAGAACGATAA(3')ATGTACGTGAAAAGCTTTGATCTTCAAGGGCTCTCGCTCTTCGATACCTTGAGACCCTCTGCACATTATT
TCAAACAGCACTCGGTGGTTAGATAGATGATGAGCAGTTTTAAATGATTTGATAGTTTGATAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan