ESTScan Details for Unigene SGN-U350732

Score 
291
Direction 
Forward
Predicted Peptide Sequence 
MASSKGIGIGGGAGGPKTTAPVTTELDKLSMEQLRAVKEQADLEVNLLQDSLSNIRTATARLDIASNALNDLSLRPQGKKMLVPLTASLY
VPGTLDDADKVLVDVGTGYFIEKTMVEGKDYCERKINLLKSNYDQLLETFYSWLLLQQNSLRILILLRLGEKECPQAKVATKKKSIADEV
GIVLQAKLRQLAPSQX
Predicted Coding Sequence 
ATGGCGTCGTCGAAGGGGATCGGAATCGGAGGAGGCGCCGGCGGGCCAAAAACCACCGCACCGGTGACGACGGAGTTAGATAAGTTAAGC
ATGGAGCAGTTAAGAGCCGTAAAAGAACAGGCCGATCTCGAAGTCAATCTTCTCCAAGACAGCCTTAGCAACATCCGCACTGCCACTGCT
CGTCTCGACATCGCCTCAAATGCTCTGAATGACCTCTCCCTCCGGCCCCAAGGGAAGAAAATGCTGGTGCCTTTGACGGCATCGCTTTAT
GTTCCGGGAACACTGGATGATGCTGACAAGGTGCTTGTGGACGTTGGCACTGGATATTTCATTGAGAAAACAATGGTGGAAGGAAAAGAT
TATTGTGAGCGAAAGATTAACTTGCTAAAGTCCAACTATGATCAGCTTCTTGAGACATTTTACTCGTGGCTACTACTGCAGCAAAATAGT
CTCAGGATACTGATCCTGTTACGACTGGGGGAAAAAGAGTGTCCCCAGGCAAAGGTGGCTACTAAGAAGAAAAGTATAGCTGATGAGGTT
GGAATTGTCTTACAGGCCAAGTTGAGGCAACTCGCGCCATCACAATAG
Edits in Original Sequence 
CAAAGTCAGAATTGGGGTACCAAAGGTCAGCAATACCAGCAGAAAGAAAAGGAAA(5')ATGGCGTCGTCGAAGGGGATCGGAATCGGAG
GAGGCGCCGGCGGGCCAAAAACCACCGCACCGGTGACGACGGAGTTAGATAAGTTAAGCATGGAGCAGTTAAGAGCCGTAAAAGAACAGG
CCGATCTCGAAGTCAATCTTCTCCAAGACAGCCTTAGCAACATCCGCACTGCCACTGCTCGTCTCGACATCGCCTCAAATGCTCTGAATG
ACCTCTCCCTCCGGCCCCAAGGGAAGAAAATGCTGGTGCCTTTGACGGCATCGCTTTATGTTCCGGGAACACTGGATGATGCTGACAAGG
TGCTTGTGGACGTTGGCACTGGATATTTCATTGAGAAAACAATGGTGGAAGGAAAAGATTATTGTGAGCGAAAGATTAACTTGCTAAAGT
CCAACTATGATCAGCTTCTTGAGACATTTTACTCGTGGCTACTACTGCAGCAAAATAGTCTCAGGATACTGATCCTGTTACGACTGGGGG
AAAAAGAGTGTCCCCAGGCAAAGGTGGCTACTAAGAAGAAAAGTATAGCTGATGAGGTTGGAATTGTCTTACAGGCCAAGTTGAGGCAAC
TCGCGCCATCACAATAG(3')GAAATTATCGACTTTTGTAATATCCAGTATCAGACTGTGCATCATAAACCTTTATGTTGACTTGCTAAC
TTCATAAACTAGTTTAGGTTTTCCTTGTTCAATTGGCGGAATGGGCTTGTGCAGAGTTAGTTGAAAAGCATATCTTAGTGCAGGTCATTG
TTGAGATTGAAGTGAGTGGAGTTAAAAGCTGACATTTTAGCGGAACATAAAAAATATCTAAAGTTTATTGTATTAACTTTAATATTAGTG
TTATTACTGCTATTCTTTTGGGTGTTTTCAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan