ESTScan Details for Unigene SGN-U351954

Score 
297
Direction 
Forward
Predicted Peptide Sequence 
LQARLNRVKQNAGEKSKEKPAESQDSXFVQHLNFLVYFKTMMGALSVSSSATLSTFLRNLPHHFRKSYASVSALSMAKAKFQLPKQRKFS
TGHRNPSFSWMATVGENVQSNASAAAPPPTSVPVRVAHELLQAGHRYLDVRTAEEFSAGHAAGAVNVPYMFRVGSGMTKNLNFVEEVLAI
FGKDDEIIVGCQLGKRSLMAATDLISAGFTGITDIAGGYAAWVQNELPTESX
Predicted Coding Sequence 
CTCCAAGCTAGACTAAACAGAGTAAAACAAAACGCTGGTGAAAAGAGCAAAGAAAAACCAGCAGAGTCACAAGACAGCTAGTTTGTTCAA
CATTTGAACTTCCTCGTATACTTCAAAACCATGATGGGGGCTCTCTCGGTTTCCTCCTCCGCTACCTTGTCAACATTTCTGCGTAATCTT
CCGCACCATTTCAGGAAAAGCTATGCATCAGTCTCAGCGCTATCAATGGCCAAGGCTAAGTTTCAACTCCCGAAACAACGCAAGTTCAGC
ACTGGCCACAGAAATCCCAGCTTCAGTTGGATGGCTACTGTTGGAGAGAATGTTCAATCAAATGCATCAGCAGCAGCACCACCACCAACA
TCAGTCCCGGTTCGTGTAGCTCACGAGCTGCTTCAGGCAGGCCATCGTTATTTAGATGTCAGGACTGCTGAAGAATTCAGTGCTGGTCAT
GCTGCTGGGGCTGTCAATGTGCCTTACATGTTTAGAGTTGGATCAGGTATGACTAAAAACCTGAACTTCGTGGAGGAAGTTTTAGCAATT
TTTGGGAAAGATGACGAAATTATTGTTGGCTGCCAATTGGGGAAAAGGTCATTGATGGCTGCAACTGATCTTATATCTGCTGGGTTTACT
GGCATTACAGACATTGCAGGTGGATATGCTGCCTGGGTACAGAATGAACTTCCGACAGAGTCGTGA
Edits in Original Sequence 
(5')CTCCAAGCTAGACTAAACAGAGTAAAACAAAACGCTGGTGAAAAGAGCAAAGAAAAACCAGCAGAGTCACAAGACAGCTAGTTTGT
TCAACATTTGAACTTCCTCGTATACTTCAAAACCATGATGGGGGCTCTCTCGGTTTCCTCCTCCGCTACCTTGTCAACATTTCTGCGTAA
TCTTCCGCACCATTTCAGGAAAAGCTATGCATCAGTCTCAGCGCTATCAATGGCCAAGGCTAAGTTTCAACTCCCGAAACAACGCAAGTT
CAGCACTGGCCACAGAAATCCCAGCTTCAGTTGGATGGCTACTGTTGGAGAGAATGTTCAATCAAATGCATCAGCAGCAGCACCACCACC
AACATCAGTCCCGGTTCGTGTAGCTCACGAGCTGCTTCAGGCAGGCCATCGTTATTTAGATGTCAGGACTGCTGAAGAATTCAGTGCTGG
TCATGCTGCTGGGGCTGTCAATGTGCCTTACATGTTTAGAGTTGGATCAGGTATGACTAAAAACCTGAACTTCGTGGAGGAAGTTTTAGC
AATTTTTGGGAAAGATGACGAAATTATTGTTGGCTGCCAATTGGGGAAAAGGTCATTGATGGCTGCAACTGATCTTATATCTGCTGGGTT
TACTGGCATTACAGACATTGCAGGTGGATATGCTGCCTGGGTACAGAATGAACTTCCGACAGAGTCGTGA(3')TGACTATGGAGGAGGG
GAACACGGGTTGTGACGCTNAATAACACAGGCTATGTACAGCGTTAGATTNATGCAAATAATTTTTTTAAAAATAAAAATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan