ESTScan Details for Unigene SGN-U562627

Score 
948
Direction 
Forward
Predicted Peptide Sequence 
SGALASVYTPLECHQPSFKIAQMGVTGRALLNLSLLPFRFPLTRNPLLPQPRRVYLGFRPLSSTTTTAPSYAAVAEEEDALQPVKHSILL
ERLRLRHLRESPKPNSEIKQLVRKQVEVDDGGVKKSKKKAVASSFEELGLTEEVMGALGEMGISEPTEIQSIGIPAVIEGKSVVLGSHTG
SGKTLAYMLPIVQLLRRDEELDGMLMKPRRPRAVVLCPTRELCEQVFRVAKSISHHARFRSTMVSGGGRLRPQEDCLASPIDMIVGTPGR
VLQHIEEGNMVYGDIRYLVLDEADTMFDRGFGPDIRKFLAPLKNRASKTDDEGFQTVLVTATMTKAVQKLVDEEFPGIEHLRTSSLHKKI
ASAX
Predicted Coding Sequence 
AGTGGAGCTTTAGCCTCTGTATATACTCCATTAGAGTGTCATCAACCAAGCTTCAAGATAGCACAAATGGGAGTTACAGGCAGAGCCCTG
CTCAACCTTTCTCTCCTCCCTTTTCGTTTTCCCTTAACCAGAAACCCTCTTCTTCCTCAGCCTCGCAGGGTTTATCTAGGGTTTAGACCC
CTTTCTTCTACAACTACTACTGCTCCTTCTTATGCTGCTGTTGCTGAAGAAGAAGATGCACTTCAACCTGTTAAGCATTCAATTCTATTA
GAAAGACTTAGACTTAGACATCTCAGAGAATCCCCAAAACCCAATTCAGAAATCAAGCAATTAGTACGGAAACAAGTAGAGGTTGATGAT
GGAGGTGTTAAGAAGAGTAAGAAGAAAGCGGTGGCGTCGAGTTTTGAGGAATTGGGGTTGACGGAAGAGGTTATGGGGGCTTTAGGTGAA
ATGGGTATTTCGGAACCGACTGAGATTCAGTCGATTGGTATACCTGCTGTGATTGAAGGGAAAAGTGTGGTATTGGGTTCACATACGGGT
TCTGGGAAGACTCTTGCTTATATGTTGCCTATTGTTCAGTTGTTGAGGCGAGATGAGGAATTGGATGGTATGCTCATGAAGCCTAGGCGC
CCCCGAGCTGTTGTGTTGTGCCCTACTAGGGAGCTCTGTGAGCAGGTTTTTCGTGTGGCAAAATCTATCAGTCATCATGCTCGATTTAGA
TCTACCATGGTTAGTGGTGGCGGACGTCTGAGACCTCAAGAAGATTGTTTGGCAAGCCCAATTGACATGATTGTGGGGACTCCAGGCAGG
GTTCTACAACATATTGAAGAGGGAAATATGGTTTATGGTGACATCAGATACTTGGTCTTGGATGAGGCTGATACCATGTTTGATCGTGGT
TTTGGTCCAGATATACGAAAATTTCTTGCGCCATTGAAAAACCGTGCTTCAAAGACTGATGATGAAGGATTTCAAACCGTTTTGGTGACG
GCAACAATGACAAAGGCAGTTCAAAAGCTGGTTGATGAGGAATTTCCAGGGATTGAGCATTTACGTACTTCTTCATTGCATAAGAAAATT
GCTTCTGCTCXX
Edits in Original Sequence 
(5')AGTGGAGCTTTAGCCTCTGTATATACTCCATTAGAGTGTCATCAACCAAGCTTCAAGATAGCACAAATGGGAGTTACAGGCAGAGC
CCTGCTCAACCTTTCTCTCCTCCCTTTTCGTTTTCCCTTAACCAGAAACCCTCTTCTTCCTCAGCCTCGCAGGGTTTATCTAGGGTTTAG
ACCCCTTTCTTCTACAACTACTACTGCTCCTTCTTATGCTGCTGTTGCTGAAGAAGAAGATGCACTTCAACCTGTTAAGCATTCAATTCT
ATTAGAAAGACTTAGACTTAGACATCTCAGAGAATCCCCAAAACCCAATTCAGAAATCAAGCAATTAGTACGGAAACAAGTAGAGGTTGA
TGATGGAGGTGTTAAGAAGAGTAAGAAGAAAGCGGTGGCGTCGAGTTTTGAGGAATTGGGGTTGACGGAAGAGGTTATGGGGGCTTTAGG
TGAAATGGGTATTTCGGAACCGACTGAGATTCAGTCGATTGGTATACCTGCTGTGATTGAAGGGAAAAGTGTGGTATTGGGTTCACATAC
GGGTTCTGGGAAGACTCTTGCTTATATGTTGCCTATTGTTCAGTTGTTGAGGCGAGATGAGGAATTGGATGGTATGCTCATGAAGCCTAG
GCGCCCCCGAGCTGTTGTGTTGTGCCCTACTAGGGAGCTCTGTGAGCAGGTTTTTCGTGTGGCAAAATCTATCAGTCATCATGCTCGATT
TAGATCTACCATGGTTAGTGGTGGCGGACGTCTGAGACCTCAAGAAGATTGTTTGGCAAGCCCAATTGACATGATTGTGGGGACTCCAGG
CAGGGTTCTACAACATATTGAAGAGGGAAATATGGTTTATGGTGACATCAGATACTTGGTCTTGGATGAGGCTGATACCATGTTTGATCG
TGGTTTTGGTCCAGATATACGAAAATTTCTTGCGCCATTGAAAAACCGTGCTTCAAAGACTGATGATGAAGGATTTCAAACCGTTTTGGT
GACGGCAACAATGACAAAGGCAGTTCAAAAGCTGGTTGATGAGGAATTTCCAGGGATTGAGCATTTACGTACTTCTTCATTGCATAAGAA
AATTGCTTCTGCTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan