ESTScan Details for Unigene SGN-U562656

Score 
688
Direction 
Forward
Predicted Peptide Sequence 
MATARIXTPKSPRKWSFTVESALTSPPAPFSSSISAVRDYSAAISPPSKAVVYDQHGSPDVVTRVTELPPVEIKDNDGALXMLAAPINPS
DINRIEGVYPVRPPLPAVGGYEGVGEVHAIGSAVKGLSPGDWVIPSPPSSGTWQTYVVKEQSVWQKVDKSTPMEYAATVIVNPLTALRML
EDFIALKSGDTIVQNGATSIVGQCVIQLARLRGIHSINIIRDRAGSDEAKAHLKQLGADEVYTESQLEVKNVRGLLGNIPEPVLGFNCVG
GNAASXDPKIPEAGWHYGDIWGDVKETDNCIYFCFYIQGTYLDRILATEVDEFNKAEERQSMIDYLLGLCRDGKLKYELEVSPFDDFHTA
LEKAMGKEEDNPNKFLNSKSRVLQHYSNLSAVSISFVVRQASLVNVSPRNNKTIGSATRCGIYSPLSNLRPGG
Predicted Coding Sequence 
ATGGCGACTGCTAGGATTGXTACCCCTAAAAGCCCTCGTAAATGGAGTTTCACCGTGGAATCCGCTCTCACGAGTCCTCCGGCTCCGTTC
TCGTCCTCTATCTCCGCCGTACGAGATTATTCCGCCGCCATTTCGCCGCCTTCTAAGGCCGTTGTCTACGATCAACACGGCTCTCCTGAT
GTAGTCACTAGAGTGACGGAGCTTCCGCCGGTGGAAATTAAAGACAATGATGGTGCGTTAGAXATGCTTGCGGCTCCGATCAATCCTTCT
GATATTAATAGAATTGAAGGAGTTTATCCTGTCCGACCACCGTTGCCTGCAGTTGGGGGATATGAAGGTGTTGGAGAAGTACATGCCATT
GGCTCTGCAGTTAAGGGTCTTTCCCCGGGAGATTGGGTTATCCCTTCCCCACCTTCTTCAGGGACATGGCAGACATACGTCGTAAAAGAA
CAGAGTGTGTGGCAGAAAGTTGATAAAAGCACCCCAATGGAGTATGCTGCGACTGTTATTGTCAATCCGTTGACTGCCTTGAGAATGCTT
GAGGACTTTATTGCATTAAAATCAGGGGACACTATTGTGCAAAATGGTGCTACAAGCATAGTGGGTCAATGTGTTATTCAACTAGCTCGA
CTCCGTGGGATTCATAGCATCAATATCATTAGAGACAGGGCAGGATCAGATGAAGCAAAAGCCCATCTCAAGCAACTAGGTGCTGATGAA
GTGTATACTGAAAGCCAACTGGAAGTGAAGAATGTCAGAGGTCTTCTGGGCAATATACCTGAACCTGTTTTAGGCTTTAATTGTGTTGGT
GGCAATGCTGCTTCAXTTGATCCTAAAATTCCTGAAGCAGGGTGGCACTATGGTGACATATGGGGGGATGTCAAAGAAACCGATAACTGT
ATCTACTTCTGCTTTTATATCCAAGGAACTTACCTTGACAGGATTCTGGCTACAGAGGTGGATGAGTTCAACAAAGCTGAAGAGCGTCAA
TCCATGATAGACTATCTATTGGGCCTATGTCGAGATGGGAAATTGAAATACGAGTTGGAAGTATCACCTTTTGATGATTTTCATACAGCT
CTGGAAAAGGCAATGGGAAAGGAGGAAGACAACCCAAACAAGTTCTTAAATTCTAAGTCACGGGTACTTCAACATTATTCTAATTTGAGT
GCTGTAAGCATAAGCTTTGTTGTTAGACAAGCCAGTTTGGTAAATGTATCCCCAAGAAATAATAAGACAATTGGCAGTGCCACTCGTTGT
GGCATCTATTCTCCTTTATCAAACTTGCGACCCGGGGGA
Edits in Original Sequence 
TGAAAAATTAGGAGTTTTGCTTAAAATAATTTGGTCAAACAAAATAAGAACACCATAGTTCATTTTGGAAGGTTCTGTA(5')ATGGCGA
CTGCTAGGATTGXTACCCCTAAAAGCCCTCGTAAATGGAGTTTCACCGTGGAATCCGCTCTCACGAGTCCTCCGGCTCCGTTCTCGTCCT
CTATaCTCCGCCGTACGAGATTATTCCGCCGCCATTTCGCCGCCTTCTAAGGCCGTTGTCTACGATCAACACGGCTCTCCTGATGTAGTC
ACTAGAGTGACGGAGCTTCCGCCGGTGGAAATTAAAGACAATGATGtGTGCGTTAGAXATGCTTGCGGCTCCGATCAATCCTTCTGATAT
TAATAGAATTGAAGGAGTTTATCCTGTCCGACCACCGTTGCCTGCAGTTGGGGGATATGAAGGTGTTGGAGAAGTACATGCCATTGGCTC
TGCAGTTAAGGGTCTTTCCCCGGGAGATTGGGTTATCCCTTCCCCACCTTCTTCAGGGACATGGCAGACATACGTCGTAAAAGAACAGAG
TGTGTGGCAGAAAGTTGATAAAAGCACCCCAATGGAGTATGCTGCGACTGTTATTGTCAATCCGTTGACTGCCTTGAGAATGCTTGAGGA
CTTTATTGCATTAAAATCAGGGGACACTATTGTGCAAAATGGTGCTACAAGCATAGTGGGTCAATGTGTTATTCAACTAGCTCGACTCCG
TGGGATTCATAGCATCAATATCATTAGAGACAGGGCAGGATCAGATGAAGCAAAAGCCCATCTCAAGCAACTAGGTGCTGATGAAGTGTA
TACTGAAAGCCAACTGGAAGTGAAGAATGTCAGAGGTCTTCTGGGCAATATACCTGAACCTGTTTTAGGCTTTAATTGTGTTGGTGGCAA
TGCTGCTTCAXTTGATCCTAAAATTCCTGAAGCAGGGTGGCACTATGGTGACATATGGGGGGATGTCAAAGAAACCGATAACTGTATCTA
CTTCTGCTTTTATATCCAAGGAACTTACCTTGACAGGATTCTGGCTACAGAGGTGGATGAGTTCAgACAAAGCTGAAGAGCGTCAATCCA
TGATAGACTATCTATTGGGCCTATGTCGAGATGGGAAATTGAAATACGAGTTGGAAGTATCACCTTTTGATGATTTTCATACAGCTCTGG
AAAAGGCAATGGGAAAGcGAGGAAGACAACCCAAACAAGTTCTTAAATTCTAAGTCACGGGTACTTCAACATTATTCTAATTTGAGTGCT
GTAAGCATAAGCTTTGTTGTTAGACAAGCCAGTTTaGGTAAATGTATCCCCAAGAAATAATAAGACAATTGGCAGTGCCACTCGTTGTGG
CATCTATTCTCCTTTATCAAACTTGCGACCCGGGGGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan