ESTScan Details for Unigene SGN-U562696

Score 
694
Direction 
Forward
Predicted Peptide Sequence 
MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITR
RETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRRAVSTEEGEQFAKENGLIFMEASAKTAQNVEEAFIKTASTIYKKIQDGVFDVSN
ESYGIKVGYGGIPGPSGGRDGAASQGGGCCT*
Predicted Coding Sequence 
ATGTCGTACGCATATCTCTTCAAGTATATTATCATCGGCGATACTGGAGTTGGAAAGTCATGTCTACTTTTGCAATTTACGGACAAACGG
TTTCAACCAGTCCATGACCTGACCATCGGGGTTGAATTTGGGGCTCGAATGATCACAATCGACAACAAACCAATTAAACTACAGATCTGG
GACACGGCTGGTCAAGAATCATTCAGATCCATCACAAGGTCATATTACAGAGGGGCTGCGGGCGCATTACTTGTTTATGATATTACAAGG
AGGGAAACTTTTAATCACCTTGCTAGTTGGTTAGAAGATGCAAGACAGCATGCAAATGCAAACATGACCATAATGCTGATTGGGAACAAG
TGTGATCTGGCTCATAGAAGGGCTGTAAGCACAGAAGAAGGTGAGCAGTTTGCCAAAGAAAACGGATTGATATTCATGGAGGCCTCAGCT
AAAACAGCTCAGAATGTTGAAGAGGCTTTCATCAAAACAGCCTCAACAATCTATAAGAAAATACAAGATGGAGTGTTTGATGTATCGAAT
GAGTCTTATGGTATAAAAGTTGGATATGGAGGCATTCCAGGACCATCAGGTGGAAGAGATGGAGCTGCTTCTCAAGGAGGGGGTTGTTGT
ACTTGA
Edits in Original Sequence 
CTCACCTGCAAATTTTTTCAACTGTCTCTCTATATTCAGATCTCCGTTGATCCACCGCCGTATCGGTAAATC(5')ATGTCGTACGCATA
TCTCTTCAAGTATATTATCATCGGCGATACTGGAGTTGGAAAGTCATGTCTACTTTTGCAATTTACGGACAAACGGTTTCAACCAGTCCA
TGACCTGACCATCGGGGTTGAATTTGGGGCTCGAATGATCACAATCGACAACAAACCAATTAAACTACAGATCTGGGACACGGCTGGTCA
AGAATCATTCAGATCCATCACAAGGTCATATTACAGAGGGGCTGCGGGCGCATTACTTGTTTATGATATTACAAGGAGGGAAACTTTTAA
TCACCTTGCTAGTTGGTTAGAAGATGCAAGACAGCATGCAAATGCAAACATGACCATAATGCTGATTGGGAACAAGTGTGATCTGGCTCA
TAGAAGGGCTGTAAGCACAGAAGAAGGTGAGCAGTTTGCCAAAGAAAACGGATTGATATTCATGGAGGCCTCAGCTAAAACAGCTCAGAA
TGTTGAAGAGGCTTTCATCAAAACAGCCTCAACAATCTATAAGAAAATACAAGATGGAGTGTTTGATGTATCGAATGAGTCTTATGGTAT
AAAAGTTGGATATGGAGGCATTCCAGGACCATCAGGTGGAAGAGATGGAGCTGCTTCTCAAGGAGGGGGTTGTTGTACTTGA(3')AACT
TGAAAATCATTCTTCAAACTTGATCATGTTCTCATCATCTCTATGCCAGCCATCATCACGGGTCTTTCATTCTTATCTTATTTGTTTTAA
TGATGTTACCTGTGCAAAAATAAGCAAAATTCAGTAAATAGTGGACAGTCCATCTTTATGTGCGCCCGTGTATAATAGTTGGCATTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan