ESTScan Details for Unigene SGN-U562775

Score 
775
Direction 
Forward
Predicted Peptide Sequence 
MGTFXLQQQLPFLEKSEQTDESLSPCGSGGVPEKGCSRIKSAVCSKEDARMNRDCEISAGSLNRRSAIISGASLISSVLLFPGEGSAVIK
QGLLAGRVPGLSEPDEEGWRTYRRPDDKSGGHGVGWSPMIPYTFSVPDKWEEVPVSIADLGGTEIDLRFANPKEGRVIVIVAPVKRFSDE
IGEEATIEQIGPPDKVISAFGPEVIGENVEGKVLRSEVAEHEGRTYYQFELEPPHVMITATAAGNRLYLFNVTGNGLQWKRYYKDLRKIA
GLSGLSELHLPHADSTLAEVDAQGRRVGHYNHNY*
Predicted Coding Sequence 
ATGGGGACATTTGXTTTACAGCAGCAGCTGCCTTTCTTGGAAAAATCTGAGCAGACAGATGAATCCCTCTCACCATGTGGTTCCGGTGGT
GTTCCAGAAAAAGGGTGTTCAAGAATTAAATCTGCTGTTTGTTCTAAAGAAGATGCTCGTATGAACCGGGATTGTGAGATATCTGCAGGA
TCATTGAATAGGAGGTCAGCTATTATATCTGGTGCTTCTTTGATTTCATCAGTACTGCTTTTTCCTGGAGAGGGATCTGCTGTAATTAAA
CAAGGTCTCCTAGCAGGGAGAGTTCCTGGACTTTCTGAACCAGATGAAGAAGGTTGGAGGACATACCGAAGACCGGATGACAAGTCAGGT
GGACACGGTGTTGGATGGAGTCCTATGATTCCTTATACTTTTTCCGTGCCTGATAAATGGGAAGAGGTCCCTGTGTCAATTGCTGATCTA
GGTGGTACAGAGATCGACTTGAGATTTGCAAATCCCAAAGAAGGGAGAGTCATTGTAATTGTGGCTCCTGTAAAAAGATTTTCAGATGAA
ATTGGTGAAGAAGCTACCATAGAACAAATTGGACCTCCAGATAAAGTGATTAGCGCATTTGGGCCTGAAGTCATTGGAGAGAATGTTGAA
GGTAAAGTCTTAAGATCTGAAGTGGCAGAGCATGAGGGAAGAACATATTACCAGTTTGAATTAGAGCCACCACATGTGATGATCACAGCA
ACGGCTGCTGGAAATCGCCTATACTTGTTCAATGTTACTGGAAATGGTCTTCAATGGAAAAGGTATTACAAAGATTTGAGAAAGATCGCT
GGTCTTTCAGGGTTGTCTGAGTTACATCTACCCCATGCTGATAGCACCTTAGCAGAGGTGGATGCACAAGGTAGAAGAGTCGGTCACTAT
AATCACAATTATTAG
Edits in Original Sequence 
TCAGATTTTGCTAGGTGTAAACCCAATCAAAAGCTCTTTTCAGTATAGCAGGAAGAGTTCATATCATAAGTTCAAAAGGACAACTCAAAA
ACATAATCAAAGAGGCTTAAATCTGGTATCTGAAATTTCCCATACTGAATAGAAATTTCTTTTTGGTTGGGAGGAA
(5')ATGGGGACAT
TTGXTTTACAGCAGCAGCTGCCTTTCTTGGAAAAATCTGAGCAGACAGATGAATCCCTCTCACCATGTGGTTCCGcGTGGTGTTCCAGAA
AAAGGGTGTTCAAGAATTAAATCTGCTGTTTGTTCTAAAGAAGATGCTCGTATGAACCGGGATTGTGAGATATCTGCAGGATCATTGAAT
AGGAGGTCAGCTATTATATCTGGTGCTTCTTTGATTTCATCAGTACTGCTTTTTCCTGGAGAGGGATCTGCTGTAATTAAACAAGGTCTC
CTAGCAGGGAGAGTTCCTGGACTTTCTGAACCAGATGAAGAAGGTTGGAGGACATACCGAAGACCGGATGACAAGTCAGGTGGACACGGT
GTTGGATGGAGTCCTATGATTCCTTATACTTTTTCCGTGCCTGATAAATGGGAAGAGGTCCCTGTGTCAATTGCTGATCTAGGTGGTACA
GAGATCGACTTGAGATTTGCAAATCCCAAAGAAGGGAGAGTCATTGTAATTGTGGCTCCTGTAAAAAGATTTTCAGATGAAATTGGTGAA
GAAGCTACCATAGAACAAATTGGACCTCCAGATAAAGTGATTAGCGCATTTGGGCCTGAAGTCATTGGAGAGAATGTTGAAGGTAAAGTC
TTAAGATCTGAAGTGGCAGAGCATGAGGGAAGAACATATTACCAGTTTGAATTAGAGCCACCACATGTGATGATCACAGCAACGGCTGCT
GGAAATCGCCTATACTTGTTCAATGTTACTGGAAATGGTCTTCAATGGAAAAGGTATTACAAAGATTTGAGAAAGATCGCTGaGTCTTTC
AGGGTTGTCTGAGTTACATCTACCCCATGCgTGATAGCACCTTAGCAGAGGTGGaATGCACAAGGTAGAAGAGTCGGTCACTATAATCAC
AATTATTAG(3')AAGCCACATCACCTCTAGTAGTATATACAGTTAAATATGTGAGAGGAGAATTTCCTCTAGAATGAGTTTTGGTAACA
AAGTTTAGCTACCAATGATTATTGTAAACTGTTTACATTACCAATATTACAAGTCTTCAGAAGGCACCTCTTCTGGATTGATCGCGACAT
CAGGCATTGATAACTCTGTTTGATTGTCACTACAATCACCTCANAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan